KEGG   Drosophila grimshawi: Dgri_GH24481Help
Entry
Dgri_GH24481      CDS       T01061                                 

Definition
GH24481 gene product from transcript GH24481-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dgr  Drosophila grimshawi
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dgri_GH24481
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dgri_GH24481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 680 aa AA seqDB search
MPELKICNHPPGKRQMADVDQQQEQRRRQQQHREKKKKQQQEKQQQQQSQSQQQQLHKQQ
APIEAFTSRQLVPVNAMLLLLLLTMLMRPRIAYANRLSDTKLHEIYLDDKEIKLSWMVDW
YKQEVLFHLQNAFNEQHRWFYLGFSKRGGLGDADICFFENQNGFFNVVTDTYTSPDGRWV
RKDYQQDCEVFKMDEFTLAFKRKFDLRSPRSTSSSLFFLSEGTMYVVWARGESELSLEDH
QFALPNVSAPHEAGLKMLQLLRADKIIIPETELDQMEITLEKAPVPNKETTYWCHVQRLD
DLVKNRLHIVQFEPIVKTPGIVHHMEVFHCETEPQIEIPLYNGDCEQLPLEAKVCSKVMA
LWAMGASTFTYPPEAGLPIGGDNFNPYVRLEVHFNNPELQPGLVDSSGFRIKLSKTLRQY
DAGVMELGLEYTDKMAIPPRQQAFPLSGYCIADCTRAALPRTGIIIFGSQLHTHLRGVRV
LTRHFRGEQELREVNRDDYYSNHFQEMRTLHYKPRVLPGDALVTTCYYNTLDDVNATLGG
FSISDEMCVNYIHYYPATKLEVCKSSVSEETLEDYFIYMKRKEHQHGIHLNGARSVNYRT
IEWTQPHIDQLYTMYIQEPLSMQCNRSDGQRFEGHNWEGVYPTAVQIKMPIHRKLCPNYN
PLWLKPLEKGECDLLGECIY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgaaaatctgtaatcatccgccaggcaaacgccaaatggctgacgtcgac
cagcaacaagaacaacgacgacgccaacaacaacatagggagaagaagaagaaacagcag
caggagaagcaacagcagcagcagtcgcagtcgcagcaacaacaactacataaacaacaa
gcaccaatcgaagcatttacatcaaggcagctggtgcctgttaatgcaatgttattgctg
ctgctgctgacgatgctgatgcgtccgcggatcgcctatgcaaatcgtctatcggatacc
aagctacacgaaatctatctggatgataaggagatcaagctgagctggatggtcgactgg
tataagcaggaggtgctcttccatttgcagaatgcgttcaatgagcagcatcgttggttc
tatttgggcttctcgaaacgtggcggattgggcgatgcggatatatgtttctttgagaat
cagaatggtttcttcaatgtggttaccgacacctacaccagtcccgatggtcgctgggtg
cgcaaggactaccagcaggactgtgaggtcttcaaaatggacgagttcacgttggccttc
aagcgcaagttcgacttgcgatcccctcgatctacgtcttcatctcttttttttctgagt
gagggcaccatgtatgtggtttgggcacgcggcgaatcggagctgtcgctcgaggatcat
cagtttgctctgcccaatgtgagtgcaccccatgaggcgggtctcaagatgctgcaactg
ctgcgagccgacaagataatcatacccgaaaccgaactggatcaaatggaaatcacattg
gagaaagcaccggtgcccaataaggagacaacttattggtgccatgtgcagcgcttggat
gatcttgtcaagaatcgtttgcacattgtgcaatttgagccgatcgttaagacgccgggc
attgtgcatcacatggaggtatttcactgcgagacagagccacagatcgagataccactg
tacaatggcgactgtgagcagctgcccctcgaggcgaaggtctgctccaaggtaatggct
ctctgggcgatgggagccagcacgtttacctatccgcccgaggcgggactacccatcggt
ggcgacaatttcaatccctacgttcgactcgaggtccacttcaataatcccgagttacag
ccaggactcgtggacagctccggtttccgcatcaaattatcaaagacactgcgacaatac
gatgccggcgtgatggaactgggcctcgagtacactgataaaatggccataccgcccaga
cagcaggcgttcccactcagcggttattgcatcgctgactgcacccgggctgctttgccc
cgcaccggcatcatcatctttggctcccagctgcatacgcatctgcgcggagttcgcgtc
ctcaccagacactttcggggcgaacaggagttgcgggaggtgaatcgcgatgattactac
tccaatcacttccaggagatgcgcaccttgcactacaagcctcgtgtgctaccgggtgat
gctctggtgacaacgtgctattataataccctagacgatgtgaatgcaacgctgggtggc
ttctcaattagcgacgagatgtgcgtcaactatattcactactatccggccaccaagttg
gaggtgtgcaaaagttccgtttccgaggagacactcgaggattactttatctacatgaag
cgcaaggagcatcagcatggcatacacttgaatggggcacgttcggtgaattatcggact
atcgaatggacacagccccacatcgaccagctgtacacgatgtacatccaggagccgctt
agcatgcaatgcaaccgatccgatggccagcgtttcgaaggacacaactgggagggtgtc
taccccaccgcggtgcaaatcaaaatgcccatccatcgcaaactgtgccccaactacaat
ccgctctggctcaagccactcgagaagggtgaatgcgatttactcggcgagtgcatctac
tag

DBGET integrated database retrieval system