KEGG   Drosophila grimshawi: Dgri_GH24516Help
Entry
Dgri_GH24516      CDS       T01061                                 

Definition
GH24516 gene product from transcript GH24516-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dgr  Drosophila grimshawi
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dgri_GH24516
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dgri_GH24516
   00603 Glycosphingolipid biosynthesis - globo series
    Dgri_GH24516
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dgri_GH24516
   00511 Other glycan degradation
    Dgri_GH24516
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dgri_GH24516
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dgri_GH24516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 624 aa AA seqDB search
MLFNRFKHCNLTLLLCAALAASIAVAVADDSSESAGNSRSKWVCDSTDLCLPEKEVLSAA
VVENNHHRFESQRDCRLSCGKYGSIWPMPTVECTLSNERVHFDPWKVRFNVVAPNPVTTQ
FLRETNRLFVSNLLKECLRNCTLGSSKEVLVKAAVNDSSLLLDWTTDEGYMMVVRTTDAV
TFVDIKASTVYGARHAFETLTNLVTGSLSNGLLLVSAARVHDRPAYPHRGLLLDTARNFM
PLRYMRNTLDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQQYGAYSTGQTYSHMDAVNL
VKYARLRGIRILLEIDGPSHAGNGWQWGPSSGMGNMSVCLNRTPWRNYCVQPPCGQLNPL
NEHMYAVLKEILEDVAELGAPEETIHMGGDEVYVPCWNHTDEITTEMKKRGYDLSEASFL
RLWSQFHQRNLQAWDEINRRMFPSVSAAKPVILWSSRLTDPEHIEQLLPKERFIVQTWVG
AQDPLNRNLLQRGYRLLISTKDAWYLDHGFWGSTSYYNWRKVYDNALPVAPRAASNQLPQ
VQQAAQVLGGEVCMWSEYVDQNSLEARIWPRAGAAAERLWSNPRSSASLAQRRFYRYRER
LIARGIHPDAVVPHWCVLHEGQCL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcaatcgtttcaagcattgtaatctcacgctcttgctctgtgcagcgctcgca
gcctctatcgcagtcgcagtcgctgacgatagcagcgagagtgccggcaacagcagaagc
aaatgggtctgcgactcgaccgatctttgcctgcccgagaaggaagtgctatccgccgct
gtggtggaaaacaatcaccaccgttttgagagtcaacgggattgtcggctatcctgtggc
aaatatggctcgatctggccaatgcccacggttgagtgcactctgtccaacgagcgggtg
cactttgatccgtggaaggtgcggttcaatgtggtcgcccccaatccggtaacaacccag
tttctacgcgaaacgaatcgcttgtttgtgagcaatctgctaaaggaatgcttgcgcaat
tgcacgctgggcagcagcaaggaggtgctggtcaaggcggcagtcaacgatagcagcctg
ctgctcgactggaccacagacgagggttacatgatggtcgtgcgcaccacggacgccgtc
accttcgtcgacatcaaggcgtcgacggtctacggagcacggcacgccttcgaaacgctc
accaatctggtcacgggcagtctgtccaatggactgctgctggtgagtgccgcacgggtg
catgatcgacccgcctatccgcatcgcggcctgctgctggacaccgctcgtaatttcatg
ccgctgcggtatatgcggaacaccctggatgcgatggcagcgtccaagttgaatgtactc
cattggcatgtggtggacacgcatagttttccgctagagataacgcgtgtgcccgaaatg
caacaatatggtgcgtattccacgggtcagacgtactcgcacatggatgccgtgaatctg
gtgaaatatgcacggctgcgtggcatacgcatcctcctcgaaatcgatggaccctcgcat
gcgggcaacggctggcagtggggaccctcctccggcatgggcaacatgtccgtctgtttg
aatcggacgccgtggcgcaactattgtgtccagccaccatgtggccaactgaatccgctg
aacgagcacatgtatgcggtgctcaaagagatactcgaggatgttgccgagctgggcgca
cccgaggagaccatccacatgggcggcgatgaggtgtacgtgccctgctggaaccacacc
gacgagataaccaccgaaatgaagaagcgcggctatgatttgagcgaggcgagctttctg
cgcctctggtcgcaatttcatcagcgcaatcttcaggcatgggatgagatcaaccgtcgc
atgtttccaagtgtcagtgcggcgaagccggtgatcttgtggtccagccgcctcaccgac
ccggagcacatcgaacagctgctgcccaaggagcgtttcatcgtccaaacgtgggtcggg
gcacaggatccgctcaatcggaatttgctgcaacgcggctatcgcctgctcatctccacc
aaggatgcctggtatttggatcacggtttctggggcagcaccagctattacaactggcgc
aaggtgtacgacaatgcgctaccagttgcaccacgcgctgccagcaaccaattgcctcag
gtgcagcaggcggctcaggtgctcggcggcgaggtgtgtatgtggagcgagtatgtggat
cagaactccctagaggcgcgcatctggccgagagcgggtgctgccgccgagcgcctgtgg
tcgaatccgagatcatccgcttccttggctcaacgtcgattctatcggtatcgggaacgg
cttatcgcacgtggcatccatccggatgctgtggtgccgcactggtgtgtgctgcacgaa
ggacaatgtctctga

DBGET integrated database retrieval system