KEGG   Drosophila grimshawi: Dgri_GH24516Help
Entry
Dgri_GH24516      CDS       T01061                                 

Definition
GH24516 gene product from transcript GH24516-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dgr  Drosophila grimshawi
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dgr00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dgr00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dgr00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dgr00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dgr00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dgr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 624 aa AA seqDB search
MLFNRFKHCNLTLLLCAALAASIAVAVADDSSESAGNSRSKWVCDSTDLCLPEKEVLSAA
VVENNHHRFESQRDCRLSCGKYGSIWPMPTVECTLSNERVHFDPWKVRFNVVAPNPVTTQ
FLRETNRLFVSNLLKECLRNCTLGSSKEVLVKAAVNDSSLLLDWTTDEGYMMVVRTTDAV
TFVDIKASTVYGARHAFETLTNLVTGSLSNGLLLVSAARVHDRPAYPHRGLLLDTARNFM
PLRYMRNTLDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQQYGAYSTGQTYSHMDAVNL
VKYARLRGIRILLEIDGPSHAGNGWQWGPSSGMGNMSVCLNRTPWRNYCVQPPCGQLNPL
NEHMYAVLKEILEDVAELGAPEETIHMGGDEVYVPCWNHTDEITTEMKKRGYDLSEASFL
RLWSQFHQRNLQAWDEINRRMFPSVSAAKPVILWSSRLTDPEHIEQLLPKERFIVQTWVG
AQDPLNRNLLQRGYRLLISTKDAWYLDHGFWGSTSYYNWRKVYDNALPVAPRAASNQLPQ
VQQAAQVLGGEVCMWSEYVDQNSLEARIWPRAGAAAERLWSNPRSSASLAQRRFYRYRER
LIARGIHPDAVVPHWCVLHEGQCL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcaatcgtttcaagcattgtaatctcacgctcttgctctgtgcagcgctcgca
gcctctatcgcagtcgcagtcgctgacgatagcagcgagagtgccggcaacagcagaagc
aaatgggtctgcgactcgaccgatctttgcctgcccgagaaggaagtgctatccgccgct
gtggtggaaaacaatcaccaccgttttgagagtcaacgggattgtcggctatcctgtggc
aaatatggctcgatctggccaatgcccacggttgagtgcactctgtccaacgagcgggtg
cactttgatccgtggaaggtgcggttcaatgtggtcgcccccaatccggtaacaacccag
tttctacgcgaaacgaatcgcttgtttgtgagcaatctgctaaaggaatgcttgcgcaat
tgcacgctgggcagcagcaaggaggtgctggtcaaggcggcagtcaacgatagcagcctg
ctgctcgactggaccacagacgagggttacatgatggtcgtgcgcaccacggacgccgtc
accttcgtcgacatcaaggcgtcgacggtctacggagcacggcacgccttcgaaacgctc
accaatctggtcacgggcagtctgtccaatggactgctgctggtgagtgccgcacgggtg
catgatcgacccgcctatccgcatcgcggcctgctgctggacaccgctcgtaatttcatg
ccgctgcggtatatgcggaacaccctggatgcgatggcagcgtccaagttgaatgtactc
cattggcatgtggtggacacgcatagttttccgctagagataacgcgtgtgcccgaaatg
caacaatatggtgcgtattccacgggtcagacgtactcgcacatggatgccgtgaatctg
gtgaaatatgcacggctgcgtggcatacgcatcctcctcgaaatcgatggaccctcgcat
gcgggcaacggctggcagtggggaccctcctccggcatgggcaacatgtccgtctgtttg
aatcggacgccgtggcgcaactattgtgtccagccaccatgtggccaactgaatccgctg
aacgagcacatgtatgcggtgctcaaagagatactcgaggatgttgccgagctgggcgca
cccgaggagaccatccacatgggcggcgatgaggtgtacgtgccctgctggaaccacacc
gacgagataaccaccgaaatgaagaagcgcggctatgatttgagcgaggcgagctttctg
cgcctctggtcgcaatttcatcagcgcaatcttcaggcatgggatgagatcaaccgtcgc
atgtttccaagtgtcagtgcggcgaagccggtgatcttgtggtccagccgcctcaccgac
ccggagcacatcgaacagctgctgcccaaggagcgtttcatcgtccaaacgtgggtcggg
gcacaggatccgctcaatcggaatttgctgcaacgcggctatcgcctgctcatctccacc
aaggatgcctggtatttggatcacggtttctggggcagcaccagctattacaactggcgc
aaggtgtacgacaatgcgctaccagttgcaccacgcgctgccagcaaccaattgcctcag
gtgcagcaggcggctcaggtgctcggcggcgaggtgtgtatgtggagcgagtatgtggat
cagaactccctagaggcgcgcatctggccgagagcgggtgctgccgccgagcgcctgtgg
tcgaatccgagatcatccgcttccttggctcaacgtcgattctatcggtatcgggaacgg
cttatcgcacgtggcatccatccggatgctgtggtgccgcactggtgtgtgctgcacgaa
ggacaatgtctctga

DBGET integrated database retrieval system