KEGG   Drosophila grimshawi: Dgri_GH24517Help
Entry
Dgri_GH24517      CDS       T01061                                 

Definition
GH24517 gene product from transcript GH24517-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dgr  Drosophila grimshawi
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dgr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dgr00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dgr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MRLVNCAVYLISCLYFGHAKAESGNSSNGNVLPVVLWHGMGDTCCFPFSLGSIKKLIMEQ
TNVSYVRSLEIGANIVLDYESGFFIHPNKQVDYVCKQLAQDEQLSNGYNAIGFSQGAQFL
RAVAQRCPVPRMRTLISLGGQHQGVFGLPKCPTLSVSSCEHITRLLNYAAYEKWVQNDLV
QATYWHDPLDESSYRLKSSFLADINNELYVNERYAENLNKLTRFVMVKFLNDTIVQPKET
QWFEFYAPGQDKTILPLNQSKVFNNLGLELMNLRGKLQFLSIEGDHLAIPKEWFVKHLVP
LLLESD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttgtcaactgtgcagtttatttgataagctgcttgtactttggccatgccaaa
gcagaaagtggcaacagcagcaatgggaatgtactgcccgtggtactgtggcacggcatg
ggcgacacttgttgtttccccttcagtctgggctccatcaagaaactgatcatggagcaa
acaaatgtcagctatgtgcgttccctcgaaatcggtgctaacattgtgctggactatgaa
agcggctttttcatacatcccaacaagcaggtggactacgtctgcaaacagctggcccaa
gatgagcaactctccaatggctacaatgccattggcttctcgcagggcgctcaattcctt
cgagcggtggcccaacgctgccccgtaccgcgaatgcgaacgctgatcagtttgggcgga
cagcatcagggtgtctttggcctgcccaagtgtccaacgctgagcgtcagcagctgcgag
cacatcacccgactcctcaactatgccgcctacgagaaatgggtacaaaatgatctggtc
caggccacatattggcacgatcctctcgacgagagcagctatcggctcaagagcagtttt
ctggcggacatcaacaatgagctgtatgtcaacgaaagatatgcggagaatctcaacaag
ctgacaagatttgtaatggtcaagtttctcaacgacaccattgtgcagccgaaggagacg
cagtggtttgagttctatgcacctggccaggataaaaccatattgccgctcaatcagagc
aaagttttcaacaatcttggactggagctaatgaatttgcgtggaaaactgcagtttcta
agcatcgaaggcgatcatctggccatacccaaggagtggtttgtgaagcatctggtgcca
ctgctgctggaatcagactaa

DBGET integrated database retrieval system