KEGG   Drosophila grimshawi: Dgri_GH24517Help
Entry
Dgri_GH24517      CDS       T01061                                 

Definition
GH24517 gene product from transcript GH24517-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dgr  Drosophila grimshawi
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dgri_GH24517
  Lipid metabolism
   00062 Fatty acid elongation
    Dgri_GH24517
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dgri_GH24517
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dgri_GH24517
Lipid biosynthesis proteins [BR:dgr01004]
 Fatty acid synthase
  Component type
   Dgri_GH24517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MRLVNCAVYLISCLYFGHAKAESGNSSNGNVLPVVLWHGMGDTCCFPFSLGSIKKLIMEQ
TNVSYVRSLEIGANIVLDYESGFFIHPNKQVDYVCKQLAQDEQLSNGYNAIGFSQGAQFL
RAVAQRCPVPRMRTLISLGGQHQGVFGLPKCPTLSVSSCEHITRLLNYAAYEKWVQNDLV
QATYWHDPLDESSYRLKSSFLADINNELYVNERYAENLNKLTRFVMVKFLNDTIVQPKET
QWFEFYAPGQDKTILPLNQSKVFNNLGLELMNLRGKLQFLSIEGDHLAIPKEWFVKHLVP
LLLESD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttgtcaactgtgcagtttatttgataagctgcttgtactttggccatgccaaa
gcagaaagtggcaacagcagcaatgggaatgtactgcccgtggtactgtggcacggcatg
ggcgacacttgttgtttccccttcagtctgggctccatcaagaaactgatcatggagcaa
acaaatgtcagctatgtgcgttccctcgaaatcggtgctaacattgtgctggactatgaa
agcggctttttcatacatcccaacaagcaggtggactacgtctgcaaacagctggcccaa
gatgagcaactctccaatggctacaatgccattggcttctcgcagggcgctcaattcctt
cgagcggtggcccaacgctgccccgtaccgcgaatgcgaacgctgatcagtttgggcgga
cagcatcagggtgtctttggcctgcccaagtgtccaacgctgagcgtcagcagctgcgag
cacatcacccgactcctcaactatgccgcctacgagaaatgggtacaaaatgatctggtc
caggccacatattggcacgatcctctcgacgagagcagctatcggctcaagagcagtttt
ctggcggacatcaacaatgagctgtatgtcaacgaaagatatgcggagaatctcaacaag
ctgacaagatttgtaatggtcaagtttctcaacgacaccattgtgcagccgaaggagacg
cagtggtttgagttctatgcacctggccaggataaaaccatattgccgctcaatcagagc
aaagttttcaacaatcttggactggagctaatgaatttgcgtggaaaactgcagtttcta
agcatcgaaggcgatcatctggccatacccaaggagtggtttgtgaagcatctggtgcca
ctgctgctggaatcagactaa

DBGET integrated database retrieval system