KEGG   Drosophila grimshawi: Dgri_GH24549Help
Entry
Dgri_GH24549      CDS       T01061                                 

Definition
GH24549 gene product from transcript GH24549-RA
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dgr  Drosophila grimshawi
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dgri_GH24549
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dgri_GH24549
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dgri_GH24549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1419 aa AA seqDB search
MSSTIEFETIGSRLQSLEVALQAQNESHEQIVLSNARGAVARVRPTTITATTPHQHHQHQ
HLHQHQHQQQQQPNAAVAVSAAAATAAAAAAASAAATAAATVTAAANAASVAANASDSSN
VNVNASPTRPTVLPAPASGIGVFGPPTRIMRPTPNLPINESGTSGTFRKRMMLPLPTQAH
PSETETDKKLKMIMGQTGKLNINDRQYPTDIRDLQHLGDLGNGTSGNVVKMLHSTSNTII
AVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKL
LKQSKKPVPEPILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISG
RLVDSKANTRSAGCAAYMAPERIDPKKPKYDIRADVWSLGITLVELATARSPYAGCNTDF
EVLTKVLDSEPPCLPFGEDYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIKIYEQAK
VDVPSWFQNVVDSAAGRRLRANGDSTLTRATTTTAAATAAATTPTSIPFYGKTTTGQQLT
AKTIKPTQIPSYQQQQQQQQQQQQLQQQQLLRGPQYFMQSATQLPQQQQHQQQQQQQQHQ
QQQSTAISSAATTTTTFNYLSSGGSNSSSSASASPISPPGGSNNNINSDNNINKLYRKSP
FMQRKLSNGSHYKYCDESPKKESVFSSIGQSILRNLTTSPFSQKKHQSIATTVTTPIQSK
ATTPIEPMTPTATTTLPHSKQQTPTEKWRLPAAAAAGEPTTAAARTTDTMLFYDTCDNSK
IVNVATELSLPLITEPTIATATATTLQLNNQQQMQHQQQQQQQQQQQRLQPGNQSPIVLQ
RFYHQQNQLREKEAAERQHHQQHHQQHHLQHQHQQQQSQQQQHQQQQHQQQQHQQQQQQH
QQQQQQHQQQQHQSHHYHYHQAAAPRPSPGTSTNPFHSNYVAPPTCGRSPSHSNMCSAAS
SSSHSHSTSSQSSTQSTCSQIAIAAPSTAAAAAATTATTTAKAATFPPPAAGHFGVGNAT
QLQYQPLPLTPTTTTTATTSPAAAATIENTPFGSQPARATTDQMQSDYAPATVGPGVPGA
PGASGASGAGTSSVLTGSKLSKLYARRQLLGQTTTTTTSGGSSSCSSSSNPDAREQLIYS
SNAESGWFHTLAGAMKRQFATYVKTQLNSTATMTSPVSNGINEQLNLNLNLNLNLETALA
PQPQPQPQQQQQQPQPQQPPAPPAYRSISLNNGSSTGKSYYYRTLSAASSSSSHSYNTSQ
STSPTTEPLAGSGVPGGAAAGHGAVTSGFLRRYASSGGVGGVGVAGGGGGGVGVGSGGSN
STPPSPHLLAGLDRRHRSPDPPPRYNRGQSPLLLRKNLLELSGQASGSPMLQRRYVSASP
PLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRIYRTIDQ
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcacaattgaatttgagacaattggaagtcggctgcaatcgctggaggttgcg
ctgcaagcacaaaacgagtcgcatgaacaaatcgtcttatcgaatgcgcgcggcgccgtc
gcccgcgtccgacccacaacaataacggcaacaacaccacatcaacatcatcagcatcaa
catctacatcagcatcaacaccaacaacaacaacaaccaaatgctgcagtcgctgttagt
gctgcagcagcgacagcagcagcggcagcagcagcgtcagcagcagcgacggcagcagcg
acagttacagcagccgcaaatgccgcctctgtcgccgccaacgcctctgactcttccaac
gtcaacgtcaacgcctcacccacaagaccgacagtgctgccggcgccagcgtcaggtatc
ggcgtatttggcccgcctaccagaattatgcgcccaacgcccaatctgcccataaatgaa
tccggtacatcggggacattccgaaaacgaatgatgttgccactgccgacacaggcacat
ccctcggaaacggaaacggataaaaaattgaagatgatcatgggccaaacgggcaaattg
aatatcaatgaccggcaatatccgacagacatccgtgatctgcagcatctgggcgatctg
ggcaatggtacaagtggcaatgtcgtcaaaatgctccactcgaccagcaacacaataatc
gccgttaaacagatgcgacgcaccggcaatgccgaggagaacaaacgcattttaatggat
ctggatgtggtgctgaaatcgcacgattgcaaatacattgtcaaatgtctgggctgtttc
gttcgtgatccagatgtctggatatgcatggagctgatgtccatgtgcttcgacaagctg
ctcaaacagtcaaagaagccggtaccagagcccatcctcggcaaagtcactgtggcgacg
gttaacgcattgtcctatctgaaggacaagcacggcgtcatccatcgtgatgtgaaaccc
tcaaacattttgatcgatgagcgcggcaacataaaactttgcgattttggcatcagcggt
cgcctggtggactccaaggcgaatacacgttccgctggctgtgcagcctacatggcgccg
gaacggatcgatccgaagaaaccaaagtatgatatacgcgccgatgtttggtcgctgggc
ataacgcttgtggaattggccacagcacgctccccgtacgcgggctgcaatacggacttt
gaggtgctcaccaaggtgctggactcggagccgccatgcctgccctttggcgaggactac
aattttagtcagcagtttcgtgattttgtcatcaagtgcctcaccaagaaccatcaagat
cgtcccaaatatccggagctgctggcccagcctttcatcaagatctacgagcaagccaaa
gtcgatgtgcccagctggtttcagaatgttgtcgactccgctgcgggcaggcggctgcgc
gccaatggtgactccacgttgacgagagcaacaacaacaacagcagcagcaacagcagca
gcaacaacaccaacatctatccctttttatggcaaaacaacaacaggtcaacagctgaca
gcaaagacaataaaaccgacacagattccaagctaccagcagcaacagcaacaacagcaa
caacagcagcaactgcagcaacaacagttgctgcggggaccgcagtatttcatgcaatca
gccacacaactacctcaacaacaacagcatcagcaacagcaacagcagcaacaacaccaa
caacaacaatcaacagcaatatcatcagcggcaacaacaacaacaacattcaactatttg
agcagcggtggcagcaacagcagcagcagcgccagtgccagtcccatctcgccaccgggt
ggcagcaacaacaacatcaacagcgacaacaacatcaataagctctatcgcaaatcgcca
tttatgcaacgcaaattgagcaatggttcgcattacaaatactgcgatgagagccccaaa
aaggaatcggttttcagcagcattggtcaatcgattctacgcaatttgaccacatcgccc
ttcagccaaaagaaacaccagtcaattgcgacaaccgtcacaacaccaatacagtcaaag
gccacaacaccaattgaaccaatgacaccaacagcaacaacaacactgccgcatagtaag
caacaaactccgactgagaagtggcgtttgccagcagcagcagcagcaggagaaccaaca
acagcagcagcaaggacaacggatacaatgttgttttatgacacctgtgataatagtaaa
attgttaatgtcgccactgaattgagcttgccgctaataacagagccaacgatagcaacg
gcaacagcaacaacgttgcagctgaacaatcaacagcagatgcaacaccaacagcaacag
cagcagcagcagcaacagcaacgactacaaccaggcaatcagagtcccatagtgctgcaa
cgcttttatcatcaacagaatcagttgcgcgaaaaggaggctgccgagcggcaacatcat
cagcaacatcatcagcaacatcatctgcaacatcagcatcagcaacagcaaagtcagcaa
cagcaacatcagcaacagcaacatcagcaacagcaacatcagcaacagcaacagcaacat
cagcaacagcaacagcaacatcagcaacagcaacatcagtcacatcattatcattatcat
caggcggctgcgccacgtccgtcgcccggcacgagcacgaatccgtttcacagcaattat
gtggcgcctcccacatgcggccgctccccctcccactcgaacatgtgctccgctgcttcg
tcgtcgtcgcactcgcactccacttctagtcaatcgtctacgcaatcgacgtgctctcaa
attgcaattgcagcaccatcaacagcagcagcagcagcagcaacaacagcaacaacaaca
gcaaaagcagcaacattcccaccgccagccgctggacactttggtgtgggcaatgcaaca
caattgcaatatcaaccgttgccactaacgccaacaacaacaacaacagcaacaacatct
ccagcagcagcagcaacaattgagaatactccatttggcagccagcctgccagagcaaca
acagaccaaatgcaatcggattatgctccagcaactgttggtcctggtgttcctggtgct
cctggtgcttctggtgcttctggtgctggaacttcatccgtgctgacgggcagcaagctg
agcaagttgtacgcacggcgtcagctgctcggccagacaacaacaacaacaacaagcggt
ggcagcagcagctgcagcagcagctccaatccagatgccagggagcagctgatctattcc
agtaatgccgaatcgggctggttccatacactcgctggcgcgatgaagcgacaatttgcg
acctatgttaaaacccaattgaattccacagcgacgatgacgtccccagtctcaaatggc
attaatgagcagctaaatcttaacctcaatctcaatctaaatctggaaacggcgctggcg
cctcaaccacaaccacaaccacaacagcagcaacaacaaccacaaccacaacaaccacca
gcaccgccagcttatcgcagcattagtcttaacaatggaagcagcacagggaaatcatat
tattatcggacactctccgctgccagcagcagcagcagtcatagctacaataccagccaa
agcacctcaccgaccacagagccactagcgggcagtggtgtcccaggcggtgctgcagct
ggtcacggtgctgtcaccagcggctttttgcgtcgctatgcaagcagtggtggtgttggt
ggtgttggtgttgctggtggaggaggaggaggagttggagttggtagcgggggcagcaat
agcacaccacccagtccgcatctgcttgcgggtctggatcgtcgacaccggagtccggat
ccgccgccgcgctacaatcgcggacaatcgccgctgctgctgcgcaagaatttgctcgag
ctgagcggacaagcgtcgggctcaccgatgctccagcgacgttatgtgtcagcatcgccg
ccgttgccgccgccacgtcgtggatcggagagtgtccccggttccccgcagcactttcgc
acccgcatccattacactcccgagccgcagagacgcatctatcggacaatagatcaatga

DBGET integrated database retrieval system