KEGG   Drosophila grimshawi: Dgri_GH24615Help
Entry
Dgri_GH24615      CDS       T01061                                 

Definition
GH24615 gene product from transcript GH24615-RA
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dgr  Drosophila grimshawi
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dgri_GH24615
Protein phosphatases and associated proteins [BR:dgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dgri_GH24615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaaacatcgctgccaatggacatgtgctccaatttcgatgcggatgagatc
cgaaggctgggcaaacgttttcgcaaactcgatctggacaattcgggggcattgagcata
gatgagtttatgtcgctgccggaattgcagcagaatccattggtgcagcgagtcatcgat
atattcgatgccgatggcaatggcgaagtcgatttcaaggaattcatccagggcgtctca
cagtttagcgtgcggggcgataagctgtcaaaattacgtttcgcctttcgcatttatgat
atggataatgatggctacatctccaatggcgaactgtttcaggtgctcaaaatgatggtt
ggcaacaatctgaaggatacgcaattgcaacagattgtcgataagaccatatgttttgcc
gacaaggatgaggatggcaaaatctcattcgatgagttctgctctgtggtcggcaatacg
gatattcataagaaaatggttgttgatgtttaa

DBGET integrated database retrieval system