KEGG   Drosophila grimshawi: Dgri_GH24648Help
Entry
Dgri_GH24648      CDS       T01061                                 

Definition
GH24648 gene product from transcript GH24648-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dgri_GH24648
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dgri_GH24648
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dgri_GH24648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 677 aa AA seqDB search
MSSNGNETVENQSSSCNSSSCNSNGSSSSGSNTEPIQLMLNSRNVSTEQAIIGVPPSPTM
QPNLFKKTTTQTAMRRNHSDGNLMAQDVKEARVRVIYTGGTIGMMRNERNVLAPIPKALV
RLIRKYPNIHDEEYAQRRFGAGASMAPLVLPYVQGEERRVLYQVTEYEPLLDSSNMTMHD
WARIANDIHQSYEFFDGFVVLHGTDTLSYTASALSFMLENLGKTVIITGSQLPIFETRTD
GKDNFTSALIIAGNYVIPEVCIFFGNKLLRGNRTVKFSSNSLDAFNSPNVPPLAKIGINV
NVDYRLIFRPCSVERFGVHLHMDENVGLLRIFPSISLATFCAFLAPPMKGVVLQSFGSGN
MPSNRTDLIDELKAAAERGVLIINCTQCPNGSVAEIYHTGKVLFDVGVIPGYDMTPEAAL
TKLSYVIGKTDWSLEVKKQMMQSNLRGELTSVAAPKMDDYDLVDAVARSLHLSSPQELDQ
LGATLFPAMINAAVAEGDIKKINNLKAYGADLSGSNHDNRTALHLACQMGDMRMVQFLLQ
NGVSVHIRDRYDRTPLQEAVSMDSHEIIQLLISCGAHLTGSSRAVGEQLCAAASRGALQR
IQSYQLAGADLSQPDPSGRTALHVAALHGFIELVHYLLPYMESSDTKDMLGLMPKDYAAR
GNHQDIVELLKTAVPNA
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtaacgggaatgaaactgttgaaaatcagagcagcagctgtaacagcagcagc
tgtaacagcaacggaagcagcagcagcggctccaacacggaaccgatacagttgatgttg
aacagtcgcaacgtgtccacggagcaggcaataatcggtgtaccgccgtcgcccacaatg
caaccgaatctatttaaaaagacaacaacacaaactgcaatgcgacgcaatcacagcgac
ggcaacctgatggcccaggacgtgaaggaggcacgtgtccgtgtcatttatacgggcggc
accattggcatgatgcgcaacgagcgcaacgtgcttgcgccgattccgaaagctttggtg
cgtctcatccgtaaatatccaaatatccatgatgaggagtatgcacagcgtcggtttggc
gccggcgcctcaatggcgccactggtgctgccatatgtccagggcgaggagagacgcgtc
ctctaccaggtgaccgaatatgagccgctcctcgactccagcaacatgaccatgcacgat
tgggcgcgtattgccaacgatatacaccaatcgtacgagttctttgatggcttcgtggtg
ctccatggcacggatacgttgtcctatacggcatcggcgctatcctttatgctggagaat
ctgggcaaaacggtgatcataacaggctcacagctgcccatctttgagacgcgcacggat
ggcaaggataactttacatcggcactgattatcgctggcaactatgtaatacccgaggtg
tgcatcttctttggaaataagctgctccgcggcaatcgcaccgtgaaattcagctccaat
tcgctggatgcgttcaattcaccaaatgtgccgccgctggcaaagattggcatcaatgtg
aatgtcgactatcgcctgatctttcgtccatgcagcgtggagcgtttcggtgtccatttg
catatggacgagaatgttgggctgttgcgaatctttcccagcatttcgctggccacattt
tgtgcatttctggccccgcccatgaagggtgttgtactccaatcatttggctcgggcaac
atgccctcaaaccgcacagacctcatcgatgagctgaaggcggccgccgagcgcggtgtc
ctcatcatcaattgcacccagtgcccgaatggctccgttgccgaaatctatcacacgggc
aaagtcctcttcgatgtgggcgttatacccggctacgatatgacgcccgaggcagccctc
accaagctctcctatgtgattggaaagaccgactggtcgctggaagtcaagaagcagatg
atgcaatcgaatctgaggggcgagctgacatcggtagcagcgcccaagatggatgactat
gatttggtcgatgctgttgcccgctcgctgcatctgtcatcgccccaggaactggatcaa
ctgggtgccacactatttccggcgatgatcaatgccgccgttgccgagggtgacatcaaa
aagatcaacaatctcaaggcatacggtgccgatttgtccggatctaatcatgacaatcgc
accgcattgcatctggcctgccagatgggcgatatgcggatggtgcaattcttactccag
aatggcgtctcggtgcatatacgggatcggtatgatcggacgccactgcaggaggctgtg
tctatggatagccatgagattatccagctgctaatcagttgtggcgcccatttgaccggc
tcctctcgtgccgttggcgagcaactatgcgccgctgcttcacgtggcgcactgcagcgc
attcaatcgtatcagctggcgggggcggatctgtcacagccggatccatctggacgcacc
gcgctgcatgtggcggcactgcatggctttatcgagctggtgcattatctactgccctat
atggagagtagcgacacgaaggatatgctcggactgatgcccaaggactatgctgctcgt
ggcaaccatcaggatattgtcgaattgctcaagacagctgtgccgaatgcctaa

DBGET integrated database retrieval system