KEGG   Drosophila grimshawi: Dgri_GH24776Help
Entry
Dgri_GH24776      CDS       T01061                                 

Definition
GH24776 gene product from transcript GH24776-RA
Orthology
K04646  
clathrin heavy chain
Organism
dgr  Drosophila grimshawi
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dgri_GH24776
   04142 Lysosome
    Dgri_GH24776
Exosome [BR:dgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dgri_GH24776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1681 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINPNSFSFSTLTMESDKFICVREKTNDTAQVVIIDMNDSAN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMSEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIEGNKEPTTLFCFAVRTATGGKLHIIEVGTPPNGN
QPFPKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNADLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGTTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLVQGKKQLCEKWLKEEKLECSEELGDLVKTSDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYIFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPTEGALQTRLLEMNLLSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTTKALIDLFESFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYSPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQY
YDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSEANPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLDNYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYMD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGDRCFTDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFSE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDTIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESGKQEIAEELLGWFLE
RNAHDCFAACLYQCYDLLRPDVILELAWKHKIMDFAMPYLIQVLREYTTKVDKLELNEAQ
REKEDDTTEHKNIIQMEPQLMITAGPAMGGIPPQYAPNYPPGAAAAAAAAAAGRNMGYPY
M
NT seq 5046 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccgcttcctattcgctttcaagagcatttacagctcacaaatgtcggcatc
aatccgaattcgttctccttcagcacgctcaccatggagtcggacaagttcatctgtgtg
cgcgagaagaccaatgataccgcccaggtggtcatcatcgatatgaacgattcggcaaat
ccgacgcgacgtcccatatcggcggactcggccattatgaatccggccagcaaggtgatt
gcgcttaaagcgcaaaagacgctgcagatcttcaacattgagatgaaatcaaaaatgaag
gcgcacacgatgagcgaggatgtggtattctggaaatggatatcgctcaatacactggcc
ctggtcaccgagacgagcgtattccattggtccatggagggtgattcgatgccacagaaa
atgttcgatagacattcctcgctcaacggctgtcagataatcaattatcgctgcaatgca
tcccaacaatggctcctccttgttggcatctcagcgcttccgagccgtgtcgctggcgcc
atgcaactgtattcggttgagcgtaaggtgtcccaggcaattgagggccatgcggccagt
tttgccacattcaaaatcgagggcaacaaggagccgacaacgctattctgtttcgctgta
cgcaccgcaaccggtggcaagctgcacatcattgaggtgggcacaccgcccaatggcaat
cagccgttcccgaagaaggccgtcgatgtattctttccgcccgaggcacaaaatgatttt
ccggttgccatgcaggtttccgccaaatatgataccatctatttgataaccaaatatgga
tatatccatttgtacgacatggaaacggccacgtgcatctacatgaatcgcatatcggcc
gatacgatttttgtgaccgcaccgcacgaggccagcggcggcattattggcgtcaatcgc
aagggacaagtactgtccgttaccgtcgatgaggagcaaattataccctatatcaataca
gtgctccagaatgccgatctcgctttacgcatggctgtacgcaacaatttggccggcgcc
gaggatctatttgtgcgtaaattcaataaactcttcaccgccggccaatatgccgaggcg
gccaaggttgccgcactggcaccgaaggccatacttcgtacaccgcaaacgattcaacgt
ttccaacaggttcagacaccggctggcacaacaacgccgcccctattgcaatactttggc
atactgctcgatcagggcaagctgaacaagtttgaatcactcgaattgtgccgacccgtg
ctggtgcagggcaagaaacagctgtgcgagaaatggctgaaggaggagaagctcgagtgc
agcgaggagctgggcgatcttgttaagacttcggatctaaccctcgccctgtccatctat
ctgcgcgccaatgtgcccaacaaggtgatccaatgctttgccgaaacgggccaattccaa
aagattgtgctctatgcaaagaaagtgaattatacacccgactatatctttctgttgcgt
tcggtgatgcgcagcaatccggagcagggcgctggctttgcatcgatgctggttgccgag
gaggaaccgctggcggatatcaatcaaatcgttgacattttcatggaacactcaatggtg
cagcagtgcacagcctttctgctcgatgccctcaagcacaatcggccaacggagggtgcg
ttgcagacacgtctgctcgaaatgaatctgttgtcggcaccccaagtggccgatgccata
ttgggcaatgcaatgttcacccactatgatcgcgcccacatcgcccagctgtgcgagaag
gctggcctattgcagcgcgcattggagcactatacggatctgtatgacattaagcgggcc
gttgtacacacccatatgctgaacgccgaatggctggtcagtttctttggcacactctct
gtggaggattcgctggagtgtttgaaggcgatgctaaccgctaatttgcgacaaaatcta
cagatctgtgtgcagatcgcaacgaaatatcatgaacagttgaccaccaaggcactaatc
gatctattcgagagtttcaagagctacgacggtctgttctatttcttgagcagcattgtc
aacttctcacaggatccggaggtgcatttcaaatatatacaggcggcgtgcaaaaccaat
cagatcaaggaagtggagcgcatctgtcgcgaatccaattgctatagtcccgaacgtgtc
aagaactttttgaaggaggccaaattgacggatcagctgccgctgatcattgtctgtgat
cgtttcgattttgtgcacgatctcgtcctatatctgtatcgcaacaatttgcaaaaatat
attgagatctatgtgcagaaagtgaatccatcccgtttgcccgtggttgttggcggtctg
ctcgatgtcgattgcagcgaggacattatcaagaacctcatattggttgtcaagggtcaa
ttctcaacggacgagctcgtcgaggaggtggagaaacgtaatcgtttgaaactattgcta
ccatggctcgagtcacgcgtccacgagggctgcgttgagccggcgacccacaatgccttg
gccaagatctacatcgattccaataacaatccggagcgcttcctcaaagagaatcaatat
tatgatagtcgcgtcgttggtcgctactgtgagaagcgtgatccccacctggcctgtgtc
gcctacgagcggggccaatgcgatcgggaactgattgccgtctgcaacgagaattcgctg
ttcaagagcgaggcacgctatttggttggacgacgcgatgccgaactgtgggccgaggtg
ctgtcggaggccaatccgtataagcgtcaactgatcgatcaggtggtgcagacggcactg
tccgagacacaggatccggatgatatctctgtgacggtcaaggcattcatgaccgccgat
ttgcccaacgaactgattgagctgcttgagaaaatcatactcgactcgtccgtgttcagt
gatcatcgcaatctacagaatctattgatattgacggcgatcaaagcggatcgtacacgt
gtcatggactacatcaatcgactggacaactatgatgcacctgatattgccaacattgcg
atcagtaatcaattgtacgaggaggcattcgccatattcaaaaagttcgatgtgaacacc
tcggcgattcaggtgctgatcgatcaggtcaacaatttggagcgtgccaatgagtttgcc
gaacgttgcaatgagccggctgtatggtctcaattggccaaggcacaattgcaacaggga
ctcgtcaaggaggcaatcgattcgtatatcaaagcggatgatcccagcgcctatatggat
gtcgttgatgttgccagcaaagtggaatcatgggatgatcttgtccgctatctgcaaatg
gcacgcaagaaggcacgtgaatcgtacattgaaagcgaattgatctatgcctatgcacga
accggacgactcgccgatctcgaggagttcatctccggtccgaatcatgcggatatccaa
aagattggcgatcgctgcttcaccgatggcatgtacgatgccgccaaattgctctacaat
aatgttagcaactttgcacgcttggccattacgctggtgtatctgaaggagttccagggc
gctgtcgattcggcacggaaagcaaattcgacgcgcacctggaaggaggtctgcttcgcc
tgtgtggatgccgaagagtttcgtttggcacaaatgtgcggcctgcacatagttgtccat
gccgatgagctggaggatttgataaactattaccagaatcgtggttattttgatgagttg
attgcactgctggaatcggcactcggcttggagcgtgcccacatgggcatgttcagtgaa
ttggcaatactctattccaagtttaagccatcaaagatgcgtgaacatttggagctgttc
tggtcgcgtgtcaatataccgaaagtgttgcgtgccgccgaatcggcgcatctatggtcg
gagctggtcttcctctatgataaatatgaggaatatgataatgctgtgctggcgatgatg
gcccatccgacagaggcgtggcgtgagggccacttcaaggacatcatcaccaaggtggcc
aacattgagctctactacaaggcaatcgaattctatttggactttaagccgctgctgctg
aacgatatgctgctcgtccttgcaccgcgcatggatcacacacgggccgtcagctatttc
tcgaagacgggctatctgccgctggttaaaccatatctgcgctccgtacaatcgctgaac
aacaaggccatcaacgaggcgctcaatggcctcctgatcgatgaggaggattaccaggga
ttgcgcaattcgattgatggtttcgataactttgataccattgcgctggcacagaagctc
gagaagcacgagctcaccgaattccgtcgcattgcagcctatctctacaagggcaacaat
cgctggaaacagagcgttgagctgtgcaaaaaggacaagctgtacaaggatgctatggag
tatgccgccgaatctggcaagcaggagattgccgaggagctgttgggctggttcctggag
cgcaacgcacacgattgctttgcggcatgtctatatcagtgctacgatttgctgcgtccg
gatgtcatcctggaactggcatggaaacacaaaatcatggactttgccatgccctacttg
atacaggtgctgcgcgaatacaccaccaaggtggataaactggagctgaatgaggcgcag
cgcgagaaggaggatgatactacggagcataaaaacatcatacagatggagccacagttg
atgataacagctggaccagctatgggcggcataccaccacaatatgcccccaattatcca
cctggcgctgcggcagcagcagcagcagcagcggccggtcgcaacatgggctatccgtat
atgtag

DBGET integrated database retrieval system