KEGG   Drosophila grimshawi: Dgri_GH24817Help
Entry
Dgri_GH24817      CDS       T01061                                 

Definition
(RefSeq) GH24817 gene product from transcript GH24817-RA
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH24817
Chromosome and associated proteins [BR:dgr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dgri_GH24817
   HAT complexes
    TIP60 complex
     Dgri_GH24817
    NuA4 complex
     Dgri_GH24817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 Acetyltransf_1 DDHD Hist_deacetyl PAT1 SprA-related Exonuc_VII_L Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 6565888
NCBI-ProteinID: XP_001992551
FlyBase: FBgn0132272
UniProt: B4JNG5
AA seq 607 aa AA seqDB search
MKPKYEFDDDVASICESTAALTEGCRLSVRMHKTDDWPLAEIVSIKELEGRRQFYVHYVD
FNKRLDEWVNEEDLDTRKVQFPRRDGPQTGTSTGVTTPKRHHSLAGSVSRPTSPQSLSGH
HGGSSSVGSAVGGGASGGGGAMGGGSGGGAELVNGNNVLAAALQKRNNRRRKVHTGSQHL
QALQQQQQPSQQQQLQLHQQQQQQQQLQQQQQMQSHPQQHLQQLATSQQQQQQQQQQQQQ
QQQQQQQQLLQQQVPSHQTPMQINSDVSMTTSGVGVGGAGGMGTGAGAVVSAIEDGSQDG
KMATPRQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQEPCIYICEFCL
KYCKSRTCLERHLTKCHLHHPPGNEIYRKNTNSFFEIDGRKNKVYAQNLCLLAKLFLDHK
TLYYDTDPFLFYIMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIE
FSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEILISQNPSTDGEKPTITINDICE
CTSIKKEDVISTLQNLNLINYYKGQYIVCISRDTIEQHQRAMVKRKIRIDSKCLHWTPKD
WSKRSKW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccaaatacgaattcgacgacgatgttgcatcaatctgtgaatcgacggctgcc
ttaaccgagggctgccgtctgtcggtgcgcatgcacaaaactgatgactggccgctggca
gagatcgtcagcatcaaggagttggagggtcggcgtcagttctacgtgcactatgtggac
tttaacaagcgcttggacgagtgggtcaacgaggaggacttggatacgcgcaaagtgcaa
tttccgcgtcgcgatggcccacaaactggtaccagtaccggggtgacgacgcccaagcgt
catcattcgcttgctgggagcgtttcacggccaacatcgccgcaatcgctgtcgggtcat
catggcggcagctccagcgtgggcagcgccgtcggcggtggagcatcaggtggcggtggc
gctatgggtggtggcagcggtggcggtgcagagctggtgaatggcaacaatgtgctagcg
gcggcgttgcaaaagcgaaacaatcgtcgtcgtaaggtgcacactggatcgcagcaccta
caagcgctgcagcagcaacagcaaccgtcgcagcaacagcagttgcagttgcatcaacaa
caacaacagcaacaacagttgcagcaacagcagcagatgcagtcgcatccacaacaacac
ttgcagcaactagcaacgtcacagcagcagcagcagcaacagcagcagcaacagcagcag
cagcaacagcagcagcagcagcagctgttgcaacaacaggtgccgtcgcatcagacgcca
atgcaaatcaactcggatgttagcatgacaacatcaggcgtaggagttggaggagccggt
ggaatgggaacaggagctggagctgttgtttcagcaattgaggatggctcacaggatggg
aaaatggcgacaccgcgtcaatcgggcagcatggtcacacatcaggatgatgtcgttaca
cgcatgaagaatgtggaaatgattgagctgggcagacatcgcattaagccgtggtatttc
tcgccatatccgcaggagctgtgccaggagccctgcatctacatatgcgaattctgtctg
aagtattgcaagagtcgcacttgcctcgagcgtcacctgaccaagtgccatttgcaccat
ccacccggcaatgagatctatcgcaaaaataccaattcctttttcgagatcgatggccgc
aagaataaggtttacgcacaaaatctgtgtctgcttgcgaaactctttttggatcacaaa
acgctgtactatgatacggatccgtttctattttatattatgactgaattcgattcacgc
ggctttcacattgtcggctacttttcgaaggagaaggagagcaccgaggattacaatgtc
gcctgtatattgacaatgccgccatatcagcgcaagggatatggcaagctgctcatcgag
ttcagctacgagctgtccaaatttgagggcaaaacgggctcaccggagaagccactctcg
gatttggggctgctctcttatcgttcctactgggcccagaccatactcgagattttgatc
agccagaatcccagcacggatggcgagaagcccaccataaccatcaacgacatttgcgag
tgcacctcgattaagaaggaggatgtcatctctacgctgcagaatctcaatctgatcaac
tactacaagggtcaatatattgtctgcattagtcgcgacaccatcgagcagcatcagcgt
gcgatggttaagcgcaagatacgcatcgactccaagtgcctgcactggacacccaaagac
tggtcgaagcgctccaagtggtaa

DBGET integrated database retrieval system