KEGG   Drosophila grimshawi: Dgri_GH24987Help
Entry
Dgri_GH24987      CDS       T01061                                 

Definition
GH24987 gene product from transcript GH24987-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dgr  Drosophila grimshawi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dgri_GH24987
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dgri_GH24987
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH24987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MSDSMKVEVKDIDKLLEQDGYLKPFEREIRRRHGVLKDWIKKIDQCEGGMEEFSQGYKYY
GLHFQPDNSVIAREWAPGAKDVYLTGDFNNWQWESHAFKKLPFGKWELHLPANADGSAPI
KHLSEIKVIIRNQSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWQPPASERYQRQHSR
PAKPKSLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFG
YQVTSFFAASSRYGNPEQLKRMIDVAHAQGLYVLLDVVHSHASKNVQDGLNQFDGTNSGF
FHDGARGEHSLWDSRLFNYTEHEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTDALNYLGLANSMLHKLDPDIITIAEDVSGMPTLCRPVSEGGIG
FDYRLGMAIPDKWIELLKEQSDDEWDVGNIVHTLTNRRWMENTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSTMSDLTLIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLD
FPRVGNNDSYHYARRQWNLVDDDMLRYKFLNDFDRDMNQLEERFGWLHTGPAYVSWKHQG
DKTIHFERAGLVFVFNFHPTQSFSDYRVGTNWAGTYQAVLSSDDPKFGGHNRIDMNCKHK
SDPFGHAGRSNFIQVYTPCRTAVVYARISD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattctatgaaggtggaggttaaggacattgataagctgctcgaacaggatggc
tatctaaagccattcgagcgtgagatacgtcgccgacatggcgtcctcaaggattggatt
aagaaaatcgatcagtgcgagggtggcatggaggagttctcgcagggctataagtattat
ggcctgcactttcagccagacaactctgtgattgcacgcgaatgggcgccgggcgccaaa
gatgtctatttaactggcgattttaataattggcaatgggaatcgcatgcgtttaagaag
ctaccctttggcaaatgggaactgcatttgccggcaaatgctgatggcagtgcacccatt
aagcatctcagcgagataaaggtcatcatacggaatcaatctggtcaattgttggatcgt
ttgtcgccatgggccaagtatgtggttcagccgcctaaaagtgccaatcagggcgtcaac
tacaagcagtacgtgtggcagccacccgcctcagagcgctatcaacgccagcattcgcgt
ccagcaaagcctaaatccttgaggatctacgagtgccatgtgggaattgcttcgcaagag
ccacgcgtgggcagctacgatgagttcgctgatcgcatcgtgccacgcatcaagcgacag
ggctacaactgcatccaggtgatggcgatcatggagcatgcctattatgccagtttcggc
tatcaggtgaccagtttctttgccgcctccagtcgctatggcaatcccgagcagctgaag
cgtatgattgatgtggcccatgcccagggtctgtacgtgctgctggatgtggtgcattcg
catgcgtcgaagaatgtgcaggatggcctcaatcagttcgatggcaccaacagtggcttc
ttccacgatggcgctcggggcgagcattccttgtgggacagtcgcctcttcaattatacg
gaacacgaagtattgcgctttctcctttccaatctgcgctggtggcacgacgagtacaat
ttcgatggctatcgtttcgatggtgtcacttccatgctgtatcattcgcgaggcattggc
gagggattcagcggcgattacaatgaatactttggcctcaacgtcgatacggatgccctc
aactatctgggcttggctaatagcatgctgcacaaactggatccggatattataaccata
gcagaagacgtttcgggcatgcccacattgtgtcgtcctgtttccgagggtggcatcggc
ttcgactatcgtctaggcatggccataccagataaatggattgagttgctcaaggaacaa
tcggatgatgagtgggatgtaggcaatattgtgcatacactgacaaatcgtcgctggatg
gagaatacggtcgcatatgctgagtctcatgatcaggcgcttgttggcgacaaaacgatt
gcgttctggctgatggacaaagagatgtatacgcacatgtccaccatgtccgatctaacg
ctgatcattgatcgtggcctggccctgcacaaaatgatacggctgattacccatgcgctg
ggcggcgaggcatatctgaatttcatgggcaatgagtttgggcatccggagtggttggat
tttccacgagtgggcaacaatgattcgtatcattatgcaaggcgtcaatggaatctggtc
gatgatgatatgttgaggtataagttcctcaatgacttcgatcgggacatgaaccagctg
gaggaacgcttcggctggctacacaccgggccggcctatgtcagctggaagcatcagggc
gataagacgattcattttgagcgtgccggtctcgtttttgtcttcaatttccatccgact
caaagttttagtgattatcgcgtcggcaccaattgggcgggcacttaccaggccgtcctc
tcctcggatgatcccaaattcggtggccacaatcgcatcgacatgaattgcaaacacaaa
tcggatccctttggccatgcgggtcgctccaatttcattcaagtctatacgccttgccgc
acagccgttgtctatgctcgcatcagcgattaa

DBGET integrated database retrieval system