KEGG   Drosophila grimshawi: Dgri_GH24987Help
Entry
Dgri_GH24987      CDS       T01061                                 

Definition
GH24987 gene product from transcript GH24987-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dgr  Drosophila grimshawi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MSDSMKVEVKDIDKLLEQDGYLKPFEREIRRRHGVLKDWIKKIDQCEGGMEEFSQGYKYY
GLHFQPDNSVIAREWAPGAKDVYLTGDFNNWQWESHAFKKLPFGKWELHLPANADGSAPI
KHLSEIKVIIRNQSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWQPPASERYQRQHSR
PAKPKSLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFG
YQVTSFFAASSRYGNPEQLKRMIDVAHAQGLYVLLDVVHSHASKNVQDGLNQFDGTNSGF
FHDGARGEHSLWDSRLFNYTEHEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTDALNYLGLANSMLHKLDPDIITIAEDVSGMPTLCRPVSEGGIG
FDYRLGMAIPDKWIELLKEQSDDEWDVGNIVHTLTNRRWMENTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSTMSDLTLIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLD
FPRVGNNDSYHYARRQWNLVDDDMLRYKFLNDFDRDMNQLEERFGWLHTGPAYVSWKHQG
DKTIHFERAGLVFVFNFHPTQSFSDYRVGTNWAGTYQAVLSSDDPKFGGHNRIDMNCKHK
SDPFGHAGRSNFIQVYTPCRTAVVYARISD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattctatgaaggtggaggttaaggacattgataagctgctcgaacaggatggc
tatctaaagccattcgagcgtgagatacgtcgccgacatggcgtcctcaaggattggatt
aagaaaatcgatcagtgcgagggtggcatggaggagttctcgcagggctataagtattat
ggcctgcactttcagccagacaactctgtgattgcacgcgaatgggcgccgggcgccaaa
gatgtctatttaactggcgattttaataattggcaatgggaatcgcatgcgtttaagaag
ctaccctttggcaaatgggaactgcatttgccggcaaatgctgatggcagtgcacccatt
aagcatctcagcgagataaaggtcatcatacggaatcaatctggtcaattgttggatcgt
ttgtcgccatgggccaagtatgtggttcagccgcctaaaagtgccaatcagggcgtcaac
tacaagcagtacgtgtggcagccacccgcctcagagcgctatcaacgccagcattcgcgt
ccagcaaagcctaaatccttgaggatctacgagtgccatgtgggaattgcttcgcaagag
ccacgcgtgggcagctacgatgagttcgctgatcgcatcgtgccacgcatcaagcgacag
ggctacaactgcatccaggtgatggcgatcatggagcatgcctattatgccagtttcggc
tatcaggtgaccagtttctttgccgcctccagtcgctatggcaatcccgagcagctgaag
cgtatgattgatgtggcccatgcccagggtctgtacgtgctgctggatgtggtgcattcg
catgcgtcgaagaatgtgcaggatggcctcaatcagttcgatggcaccaacagtggcttc
ttccacgatggcgctcggggcgagcattccttgtgggacagtcgcctcttcaattatacg
gaacacgaagtattgcgctttctcctttccaatctgcgctggtggcacgacgagtacaat
ttcgatggctatcgtttcgatggtgtcacttccatgctgtatcattcgcgaggcattggc
gagggattcagcggcgattacaatgaatactttggcctcaacgtcgatacggatgccctc
aactatctgggcttggctaatagcatgctgcacaaactggatccggatattataaccata
gcagaagacgtttcgggcatgcccacattgtgtcgtcctgtttccgagggtggcatcggc
ttcgactatcgtctaggcatggccataccagataaatggattgagttgctcaaggaacaa
tcggatgatgagtgggatgtaggcaatattgtgcatacactgacaaatcgtcgctggatg
gagaatacggtcgcatatgctgagtctcatgatcaggcgcttgttggcgacaaaacgatt
gcgttctggctgatggacaaagagatgtatacgcacatgtccaccatgtccgatctaacg
ctgatcattgatcgtggcctggccctgcacaaaatgatacggctgattacccatgcgctg
ggcggcgaggcatatctgaatttcatgggcaatgagtttgggcatccggagtggttggat
tttccacgagtgggcaacaatgattcgtatcattatgcaaggcgtcaatggaatctggtc
gatgatgatatgttgaggtataagttcctcaatgacttcgatcgggacatgaaccagctg
gaggaacgcttcggctggctacacaccgggccggcctatgtcagctggaagcatcagggc
gataagacgattcattttgagcgtgccggtctcgtttttgtcttcaatttccatccgact
caaagttttagtgattatcgcgtcggcaccaattgggcgggcacttaccaggccgtcctc
tcctcggatgatcccaaattcggtggccacaatcgcatcgacatgaattgcaaacacaaa
tcggatccctttggccatgcgggtcgctccaatttcattcaagtctatacgccttgccgc
acagccgttgtctatgctcgcatcagcgattaa

DBGET integrated database retrieval system