KEGG   Drosophila grimshawi: Dgri_GH25064Help
Entry
Dgri_GH25064      CDS       T01061                                 

Definition
GH25064 gene product from transcript GH25064-RA
Orthology
K11252  
histone H2B
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaactagtggaaaggcagccaaaaaggctggcaaggctcaaaagaacatt
accaagaatgacaagaagaagaagcgcaagaggaaggaaagctatgccatctacatttac
aaagtgttgaagcaagtccatcctgacacaggcatttcgtcaaaggcaatgagcatcatg
aacagcttcgtgaatgatatttttgagcgtattgctgccgaggcatctcgtttggcccac
tacaacaaacgttcaaccatcacaagtcgggaaatccaaaccgctgtccgtcttttactg
cccggagagttggctaagcacgccgtcagtgagggaaccaaagcagtcaccaagtacact
agctccaagtaa

DBGET integrated database retrieval system