KEGG   Drosophila grimshawi: Dgri_GH25080Help
Entry
Dgri_GH25080      CDS       T01061                                 

Definition
GH25080 gene product from transcript GH25080-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dgr  Drosophila grimshawi
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dgri_GH25080
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dgri_GH25080
Glycosyltransferases [BR:dgr01003]
 Glycan extension
  Type 3 chain
   Dgri_GH25080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 308 aa AA seqDB search
MGLISALEGRSSKHAFVSIIVVLIIGFFLAVLFIYWSTPERDDYVPYLRRGHAHHSHDML
ELAGPEQDVGTHDHVNENTSIAEKLYSEVRILCWIMTSPANHQKKARHVKRTWGKRCNKL
IFMSSAKDEELDAVALPIGEGLDNLWGKTKEAFEYIYEHHMNDADWFLKADDDTYMIVEN
LRYMLYPYNPNTPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEAIPNPKLCKKEN
TGREDVEIGKCLENVKVLAGDSRDTNGRGRFFAFVPEDHLIVHVDKEYWYWKYIYYKTDE
ASFFKFKL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggactaatctctgcattagaaggacgttccagcaagcatgcttttgtctcaatcatt
gtcgtcttgatcattggcttcttcctagcagtgcttttcatttattggtccacgccggaa
cgtgacgactacgtgccgtacctccgacgtggccatgcgcatcatagtcacgacatgctg
gagctggccggcccagaacaggatgtgggcacacacgatcatgtcaacgaaaacaccagc
attgcggagaagctgtacagcgaggtgcgcattctctgctggataatgacgagtcccgcc
aaccatcagaagaaagcgcgccacgtgaagcgcacctggggcaagcgttgcaataagttg
atcttcatgagctcagccaaggatgaggagctggatgccgtggcgctgcccatcggcgag
ggtctcgataatctgtgggggaaaacaaaggaagcatttgagtacatctacgagcatcac
atgaacgatgcagactggttcctcaaagcagacgatgacacctatatgattgtagagaat
ttgcgctatatgctatatccctacaatcccaacacgccagtctattttggctgcaaattc
aagccgtatgtcaagcaaggctacatgtccggtggagctggttatgtgcttagtcgcgag
gctgtgcgtcgcttcgtggtcgaagctattcccaatccgaagctgtgcaagaaggaaaac
actggccgcgaggatgtggaaataggcaagtgcttggagaacgttaaggttctggcaggc
gattcccgagataccaatgggcgtggtcgcttctttgcttttgtgccggaggatcacttg
atcgtgcatgtggacaaggaatactggtactggaagtacatctattacaaaaccgatgag
gcgagttttttcaaattcaagttgtag

DBGET integrated database retrieval system