KEGG   Drosophila grimshawi: Dgri_GH25123Help
Entry
Dgri_GH25123      CDS       T01061                                 

Definition
GH25123 gene product from transcript GH25123-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dgr  Drosophila grimshawi
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:dgr00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 389 aa AA seqDB search
MTANSLLGRSLLNEGRSNKRSFVSLIVGLIVGFCLAELFVYSSTPERAEYVPYDGHRHGD
VNDAHHSHDMLELAGPEQDVGTHDHVHENTSIAEKMYSEVRILCWIMTNPANHQKKARHV
KRTWGKRCNKLIFMSSAKDEELDAVALPIGEGRNNLWGKTKEAYKYIYEHHMNDADWFLK
ADDDTYTIVENLRYMLYPYNPDTPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEA
IPNPKLCKKENTGAEDVEMGKCLENIKVLAGDSRDANKRGRFFPFVPEHHLIPSHTDKKF
WYWQYIYYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIVNTPDVLPNKLGL
GELMPTPKESKEQNEPETSDTVQTQKGAQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgactgccaatagcctgctaggacgatccttacttaacgaaggacgttccaacaagcgt
tcttttgtctcactgattgtcggcctaatcgtcggcttctgcctcgccgagcttttcgtc
tactcatccacgccggaacgtgccgagtacgtgccgtacgatggtcatcgacatggcgat
gtcaacgatgcacatcacagtcacgacatgctggagctagccggtccagagcaggatgtg
ggcacacacgatcatgtgcacgaaaacaccagtattgcggagaagatgtacagcgaggtg
cgcattctctgctggataatgacgaatcccgccaaccatcagaagaaagcgcgccacgtg
aagcgcacctggggcaagcgctgcaataagttgatcttcatgagctcagccaaggatgaa
gagctggatgccgtggcgctgcccatcggcgagggacgcaacaatctgtggggaaaaaca
aaggaagcatataagtacatctacgagcatcacatgaacgatgcagactggttcctcaaa
gcagacgatgacacctatacgattgtagagaatttgcgctatatgctatatccctacaat
cccgacacgcccgtctattttggctgcaaattcaagccatatgtcaagcaaggctacatg
tccggtggagctggttatgttctcagtcgcgaggctgtgcgtcgcttcgtggtcgaagct
attccaaatccgaaactttgcaagaaggaaaacacaggcgccgaagatgtggaaatgggc
aagtgcttggagaacattaaagttctggcgggcgattcccgagatgccaacaagcgtggt
cgcttctttccttttgtgccggagcatcacttgataccttcgcatacggacaagaaattc
tggtactggcagtacatctattacaaaaccgatgagggtctggactgctgttcggacaat
gccatctcatttcattatgtctcacccaatcaaatgtatgtgctggactatttaatatat
catctgaggccatacggaatcgtgaatacgccagatgtgctaccaaataaactcggcctg
ggtgaactaatgccgactcccaaagagtccaaggagcaaaatgagccagagacatcagat
actgttcaaacgcaaaagggcgcgcagtag

DBGET integrated database retrieval system