KEGG   Drosophila grimshawi: Dgri_GH25310Help
Entry
Dgri_GH25310      CDS       T01061                                 

Definition
GH25310 gene product from transcript GH25310-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dgr  Drosophila grimshawi
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dgri_GH25310
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1349 aa AA seqDB search
MDVNGTMERRFSLSNSPRLTNPIADSTWIDGMPVTQRAAARQLYRNLSGAQRSNSSSCLS
NGYTNETPPNRYLHQTSRTSTSISKMTRQKLNLSQLDPKTYADVHSSGLTSRIAGYQQES
SRGLQRSMSYNNVYNPMTLPRRIAPLNKRVLPAVSITHIAPPERSFFCGSTLPSLLRSNS
LLGVEKNTEQLSRENRPIMHPPPLQHESEPTRSVLEELKEISRKRINSGEIQPNDFKKSC
SRMTDYVDHHHHHPQQQQQHQQQQQQQLSMLQLQSGLKRQRELTVTVPLRQYHSPISLSH
QLHQQQQQHHQQHHHQQFQMSGHHYSVSVSPEQLAKRRNCSHSNEIAGSLSSSKLLSSKR
QLNSSTVSGSSSSSSPESSPRQQVAKIQRNQSNTINLHLEHLTRAQSVPITPLPATPAQR
TQSAPEPNLQAVPKPETPAKPKLTLFNASQHQKQQQQQQQQSQREQEFDLDSPDVDASEY
AGIQFVKPKQQNALGTQKNSNLERTQKTKLALMLSSLKGEIYQDETDLSDEPDAMTTPIK
PTTIATTRTATLTTATATTTTTKPIILGVKTIAPAPTISTANTAATTTTTITTTTTITTT
TSNTSLPLLSFNTTAKSTASATTATAAAAAATATTLMTTANNNNALPFLSLNNAAVIKTP
NKESSTTLNTSTAFTLPTTTSQTAGASPTLIPKLNFTPTTIGTTITMPPALNFNQLPTIA
PAAAAAAAATTVTTTTTTSIAPMFSFGNATTKAAAAVTTTTNTPAAAPAMFTFGKPATAA
TTISTTVASATTVTAAATTDANASLFSFGNATTAAATTAATSASIFSFGNATGAATATTT
APTGAAASKPFTFGNISNNNAAAATVDAAAVPALKLNNWTQKPTEAATFNNNGNNVFGKP
AIVAEPTKLFSFGNSSANGPAATSVVASTTAPVATPAATPIFGGATAAVAAKPAFSFGGA
ATAAATAPPAASNANLFSFGGATSDSAKPVAKATPFTLPNSSSNNTSNLFKFGDSDTGPK
MTITTTAAAPAPAASFNFNARAAATTPNPSSTFSFGATPRATPTFGSTSSSNNNATAAKP
FAFGGATEQQQQAAAGTQTPQQPRTGGFSFAAVAQKNESTNLFGSPTATPSAAAAAGATS
AAPATGIVKPSFNFGSNSTTPSSATAAATASPSFGGFAVPAAPAGNQNKPFAFGASATQN
NSSSPMGGNLFASAVAAAQQQQQQQSKPGVFSFNSNSRSAASPPQAATGNAPFAFGGVTS
PAQSNNTAKPFTFGASANNNATASNVFGSPAAAPTAASPASSGVFNFGGTTAAPRMPTTP
QQLNSGNFFAPPSTPENRPIRRATRRLQK
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
atggacgttaacggaacaatggagcgtcgcttcagcctaagcaactctccgcgcttaaca
aaccccattgcggattccacatggattgatggcatgcctgtcacacagcgagcagcggcg
cgccagctatatagaaacctaagtggcgcgcagcgcagcaactcgagcagctgcttaagc
aatggttacacaaatgaaacgccgccaaacagatatctgcatcagacatcgaggacctcc
acaagcatatctaaaatgacacgccaaaagctaaatctcagccagcttgatcccaaaacc
tatgcggatgtgcacagcagcggattgacctcacgcattgctggttaccagcaggagagt
agtcgtggcctgcagcgcagcatgtcctacaacaatgtgtacaatccgatgacactgcca
cgacggattgctccattaaataagcgcgtactgcctgcggtatcgataacgcacattgcg
ccgcccgagcgtagttttttctgcggcagtacgttgcccagtctgctgcgctcgaattcg
ctgctgggcgtggagaagaacaccgagcagttgtcgcgcgagaatcgacccataatgcat
ccgccgccattgcagcatgaaagcgaaccgacgcgcagcgtcctcgaggagctgaaggag
atttcgcgcaagcgaatcaacagtggcgaaatacaaccgaatgatttcaaaaagagctgc
agtcgtatgactgattacgttgatcatcatcatcatcatccacaacagcagcagcaacat
cagcagcagcagcagcagcagttgtccatgttgcagctgcagtcgggccttaagcggcag
cgtgaacttactgttacggtgcctctgcgacagtatcattcaccaatatcgctgtctcac
cagctccatcaacaacaacaacaacaccatcagcagcatcaccaccaacagtttcaaatg
tctggacatcattattcagttagcgtttcgccggagcagctggccaaacgtcgaaattgc
agtcacagcaatgaaattgccgggtctctcagctccagcaagctgctcagcagcaagcgc
caattaaactcatccaccgttagcggcagcagcagcagcagctcgccggaaagctcacct
cgccaacaggtggcgaaaatacagcgcaatcagagcaacacaatcaatctacatctggag
catttgacgagagcgcaaagtgtgccgattacaccgctgccggcaacgcctgcacagcgc
acacagtccgcgcccgagcccaatctgcaggcggtaccaaaaccggagacgcccgccaaa
ccaaaactgacattgttcaatgcatcgcaacatcaaaaacaacaacagcagcagcaacag
cagtcgcagcgtgagcaagaatttgatctggacagtcccgatgtggatgccagcgaatat
gcgggcatacaatttgtcaagccgaagcaacagaatgcgctgggcacccaaaagaattcc
aatttggagcgtacacaaaaaaccaagctggcgcttatgctaagcagtttgaagggtgaa
atctaccaggatgagacggacttgtctgacgagccggatgcgatgaccacgcccattaaa
ccaacgacaattgcaacaacaagaacagctacactaacaacggcaacagcaacaaccaca
accacaaagccaattatactgggtgtaaaaaccattgcgccagcgccaacaatttcaaca
gcaaacaccgcagcgacaacaacaactacaataacaacaacaactactataacaacaaca
acaagcaatacctctttaccgttgctttcatttaacacaacagctaaaagcaccgcatca
gcaacaacggcaacagcagcagcagcagcagcaacagcaacaacattaatgacaacagca
aacaacaacaatgctttgccttttctttcattaaacaacgctgcagtaatcaaaacaccc
aacaaggaatcatcaacaactttgaacacctcaacagcctttacactgccgacaacaacg
agccaaacagcaggcgcctcaccgactcttattccaaaacttaactttacaccaacaaca
attgggacaacaataacaatgccgcctgcattaaactttaaccagctgccaacgatagca
ccagcagcagcagcagcagcagcagcaactacagtaacaacaaccacaacaacaagcatc
gcgccaatgttttcatttggaaatgcaaccacaaaagcagcagccgcagtaacaacgaca
accaatacaccggcggctgcaccagcaatgttcacttttggcaagcccgcaactgcagca
acaacaatcagcacaacagttgcatcagcaacaacagttacagcagcagcaacaacagat
gcaaatgcttctttgtttagtttcggcaatgcgacaacagcagcagcaacaacagcagct
acaagcgcgtcaatatttagttttggcaatgctacaggtgcagcgacagcaacaacaacg
gcaccaacaggcgcagcagctagcaaaccattcacatttggcaacatcagcaacaataat
gcagcagcagcaacagttgatgccgctgctgtgcctgccttaaagctgaataactggacg
cagaagcccacagaagccgcgacctttaacaacaacggcaacaatgtctttggcaaaccg
gcaatagtcgctgagcccacaaaactgtttagctttggcaacagttcagcgaatgggcca
gctgccacgtccgttgtcgcgtcgactaccgcgccagttgcaacgcccgcagcaacgcct
atttttggtggagccactgcagcagtagctgcaaagccagcttttagtttcggcggcgcg
gcaacggcagcagcaacagccccgcccgctgctagcaacgcgaatctattctcatttggc
ggtgccacaagcgattcagctaagcctgtggcaaaagcaacaccatttacgctgcccaac
agcagcagcaacaacaccagcaatctatttaaatttggcgacagcgatactggacccaaa
atgacaataacaacaacagcagcagcgccagcacctgcagccagctttaattttaatgcc
agagcagcagcaacaacaccaaaccccagcagcacattcagtttcggtgccacgccgaga
gcgacgcctacgtttggcagcaccagcagcagcaacaacaatgcaactgctgcaaagcct
tttgcatttggcggtgccacagagcagcagcagcaggcggccgcaggaacacagacgcca
caacaaccacgcactggcggcttctcctttgctgcagtggcgcagaaaaatgagtccaca
aacttatttggctcaccaacagcaacaccatcagcagcagcagctgcaggagcaacatca
gcagcaccagcaacgggcattgtaaagcctagttttaattttggaagtaactcaacaaca
ccatcatcagcaacagcagcagcaacagcatcgcccagtttcggaggttttgcggtgcca
gcagcgccggcgggcaatcaaaacaaaccatttgcatttggcgccagtgccacgcaaaat
aattccagttcgccaatgggcggcaatctgtttgccagtgctgtggccgctgcacagcag
cagcagcagcaacagtcaaagccaggcgtcttctcatttaacagcaacagcagaagcgct
gcatcgccaccgcaagcagcaactggaaatgcaccatttgcattcggtggtgttacttca
ccagcgcagagcaacaataccgctaagccgtttacatttggcgccagcgccaacaataat
gcaacggccagcaatgtttttggcagcccagccgcagcgccgacagcagcatctcctgcg
agcagtggagtctttaattttggtggcaccacagctgcaccgcgcatgccaaccacaccg
cagcagctcaacagtggcaatttctttgcgccgccaagcacccccgaaaatcgacccatt
cgacgagcaacgcgacgcctgcaaaagtag

DBGET integrated database retrieval system