KEGG   Drosophila grimshawi: Dgri_GH25312Help
Entry
Dgri_GH25312      CDS       T01061                                 

Definition
GH25312 gene product from transcript GH25312-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dgr  Drosophila grimshawi
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dgri_GH25312
   04150 mTOR signaling pathway
    Dgri_GH25312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 982 aa AA seqDB search
MASKSDNGIVLSGFQKKLKTMKKKFFVLYKETNNGAARLEYYDTEKKFLQKTAPKRVIDL
KSCFNINRRFDTKHKFVLALASRDGGFGIVLNSENDLRKWLDNLLILQRDNTPYEYVWQV
VVQKKGMSETVGITGGYHCCLTSKSLTFICIGPEKQPNGDGRLLKVEINLPTIRRCGHAA
PQSIFYMELGRQSVLGAGELWMETEDSAAKHMHDMILSAMSVKSESNMNLLNVYKGKPDL
GSEPMRKRSSSATEASKPINVLQKRQNPIEIRNSFSPQYNSYGRERCDSLPSRNRTLSEC
SNQTYIAYKHGHRCNTISGTRPYSSQRHSDSPPINSAMKCSESEESSISIDEANDKSIYD
AYRINSRTSKCMIPEENVDDLNVSDSNKLSGINENFAHYISMTPNKSMCENLNVNANHQL
NQCTELNTFCNVVEEDFIDFPEHSSEKLAKDAEIDNQYERPSRAYSIGSKVEHIKMSKPL
GNLNEVDNSSPRVRAYSVGSKSKIPRCDIQRCVLFSNKGKNWGHTHKGSVCNVDVQACSE
HIGYNTSREMKSTSAPLLNLRSYVNPLRMSDLMEIDFSNVTTASSTTQQPRAVLRNYHQQ
QPSAIQTKKNPVAILPNSSSNGNIRQITEMLKPETIPKSVDSSDVGYLEMKPVGVGIVHM
SHRPPICIEDQLEKLKLLNSTQQQQLVSPPLQHTRMLQPDKLQMNNDNSNCYAVSETNAD
LSDTNTILTNNLNQNNADKNYHLIKSHMNRRGMHTKLENNQLEKTLFNFALDISNSTPTA
GRKLIHSISNEDYTKHINKSNAGPDTKGIGYQILQIKSDSSLISKKKNQRPIHKPQYGRQ
FSIDGAHKMEKKLLITNTTPTATTTTTNTACNNLSSPSSSLLLNKPESKLLNEDSVSNKD
ASSTNKDDNASSSSGSGDHALYYASLDLPQSSGQTTTKCLKKVACESPPANVVCFENTTS
SYAKIDFDQSDSSSASSKICNI
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaagtcagacaacggaatcgtactaagtggatttcagaagaaattgaaaacg
atgaaaaagaaattctttgtgctctataaggaaacgaacaatggcgctgcccgtttggaa
tattatgatacggaaaagaaatttctgcagaaaactgcgccaaaacgcgtcatagatctg
aagagctgcttcaacatcaatcgtcgtttcgatacgaaacataaatttgtattggctctc
gcatcgagagatggcggttttggcatcgttttgaactcagagaatgatttacgcaaatgg
ttagataatctgttaatcctacaacgagataatacaccctacgaatatgtttggcaagtt
gttgtccaaaagaagggaatgtcggagactgtcggaattacgggcggttaccactgctgc
ctgacctcaaaatcgcttacattcatctgtataggaccggaaaaacaaccaaatggcgat
ggtcgcctcttgaaagttgagataaatttaccaacaataagacgatgtggacacgcggcg
ccacaaagcattttttatatggaactgggccgccagagtgttctgggtgccggtgaactg
tggatggaaacggaagattcagctgccaaacatatgcacgatatgatattaagcgcaatg
tccgtcaaatccgagtcgaatatgaacttgttgaatgtgtacaaaggaaaacctgattta
ggaagtgaaccgatgaggaaacgttcgtcatcagcaacggaggcttccaagccaattaac
gttctacaaaaacgacaaaatcctattgaaatacgaaatagtttttcgccgcagtacaac
agttacggacgagagcgatgcgacagtttaccaagcaggaatcggacactgagcgagtgc
agcaatcaaacatacattgcatataagcatgggcatcgatgtaacacgatatcgggaaca
cgcccatactcgagtcagagacacagtgatagcccaccaattaattcagcaatgaaatgc
tcggagagcgaagagtcatcaattagtattgatgaggcgaatgataaaagcatctatgac
gcttatcgaataaactcaaggacctcgaaatgcatgatacccgaagagaatgttgatgat
ttaaatgtgtccgatagcaacaaattgtctggaataaatgaaaactttgcacactatatt
tctatgaccccaaacaaatcaatgtgcgaaaatctgaatgtgaatgcaaatcatcaattg
aatcaatgcacagaattaaacacattttgtaatgttgtcgaggaagactttatcgatttt
cccgagcactcatccgagaaactcgctaaagatgccgaaatcgataaccagtatgaacgt
ccaagtcgtgcatattcaattggcagtaaagtcgagcacattaaaatgagcaaaccgcta
ggaaacttgaatgaagtggataattcatcgccacgagtgcgcgcctattccgtgggatcg
aagtcaaagatacctcggtgcgatattcagcgttgcgtgctcttctccaacaagggaaag
aattggggacacacgcataagggtagcgtttgcaatgtcgatgttcaggcatgcagtgaa
catatcggttataatacgtccagggaaatgaagtcgacaagtgctccactcttgaatcta
cgcagctatgtgaatccactccgtatgagtgatttaatggaaatcgatttctccaatgtg
acgacagcatcttccacaacgcaacaaccacgtgccgtgttacgaaattatcatcaacag
cagcctagtgcaattcaaacgaaaaagaatcccgttgctatattgcccaactcgagttca
aatggtaatattcggcaaattacggaaatgctcaaaccggagacaataccaaaatctgta
gacagctcggatgtcggttatttggaaatgaaacccgttggcgttggcatcgtgcatatg
agtcacagaccgcccatatgcattgaggatcagttggaaaagttaaagctgctgaatagc
acacagcagcaacagctggtgtccccgccgctgcagcatacacgaatgctgcagccggat
aaattacaaatgaataatgataatagcaattgctatgccgtgagcgaaactaatgccgat
ttgtccgacaccaatactatattaacaaataatttaaatcaaaataatgctgataagaat
tatcatcttatcaaaagtcacatgaacagaaggggtatgcacaccaaattggagaacaat
caattggagaaaacattattcaactttgccttagatataagcaacagcacgccgacagcg
ggccgaaagttaatacattcgataagtaatgaagactatacgaagcatataaataaatcg
aatgccgggccggacactaaaggaattggctaccaaattcttcaaattaaaagtgatagt
tccctaatttcaaaaaagaaaaatcaacggccaatccataagccacaatacgggcgacaa
ttttcgatcgatggtgcccataaaatggagaaaaaactgttaataacaaacacgacacca
acagcaaccacaacaacaacgaacacagcatgcaacaacttgtcgtcgccgtcgtcgtcg
ttgttgttaaataaaccggaatcaaaactattgaatgaggattcagtgtcgaacaaggat
gcctcatcaacaaataaggatgacaatgcatcgtcatcgtcgggctcgggcgatcatgca
ctctattatgccagtctagaccttccacagagcagcggacagacgacaacaaagtgtctg
aagaaagtcgcatgtgaatctccgccagcgaatgttgtttgctttgaaaacaccaccagt
tcatatgcaaaaatagattttgatcaatcggactcctcgtctgcttcatcaaaaatttgt
aatatctaa

DBGET integrated database retrieval system