KEGG   Debaryomyces hansenii: DEHA2A02926gHelp
Entry
DEHA2A02926g      CDS       T01026                                 

Definition
(RefSeq) DEHA2A02926p
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
dha  Debaryomyces hansenii
Pathway
dha00072  Synthesis and degradation of ketone bodies
dha00280  Valine, leucine and isoleucine degradation
dha00650  Butanoate metabolism
dha00900  Terpenoid backbone biosynthesis
dha01100  Metabolic pathways
dha01110  Biosynthesis of secondary metabolites
dha01130  Biosynthesis of antibiotics
Module
dha_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    DEHA2A02926g
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    DEHA2A02926g
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DEHA2A02926g
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DEHA2A02926g
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     DEHA2A02926g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N
Motif
Other DBs
NCBI-GeneID: 2899707
NCBI-ProteinID: XP_456470
UniProt: Q6BZ99
Position
A:249361..250707
Genome map
AA seq 448 aa AA seqDB search
MTKPQNVGIKGIEVYVPSQCVNQTELEKFDGIAAGKYTIGLGQTNMSYVNDREDIYSLSL
TVLSKLIKNFGVDTNQVGRLEVGTETLLDKSKSVKSVLMQLFEGNNDIEGIDTINACYGG
TSAVINTVNWIESSSWDGRDGIVVCGDIAIYSKGAARPTGGAGAVALLIGPDAPIVFEST
RGSFMEHAYDFYKPDFTSEYPIVDGHFSLACYVKAVDQCYKNYSKKVTKDDNKTVGVFDH
FDYNAFHVPTCKLVTKSYARLLYNDYKADPSKFKDLIDEETKKSIDSLTYDQSLVDKNLE
KIFVGLAKEQTKTRVQPCLNVPTNTGNMYSASAWASLSSLLYYVGSEQLQNKRIGVFSYG
SGLASTLLSVVVKGDISKITKNLDFDHKLSEGRVTRTPEQYLEAIELREKAHLQKSFKPS
GSIETLARGTYYLTEIDDKYRRQYNKKD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccacaaaacgtaggtatcaaagggattgaagtttatgttccttcacaatgt
gttaaccaaacagaattagaaaaattcgatggaattgccgctggaaaatatacgattggg
ttaggacaaaccaatatgtcatatgtcaacgacagagaagatatttactccttgtcattg
acagtcttatctaaattgatcaagaacttcggagttgacaccaaccaagttggtagattg
gaagtaggtaccgagacgttgttggacaaatccaagtcggtgaagtctgtgttgatgcaa
ttattcgaaggaaacaacgatattgaagggattgacacgatcaatgcgtgttatgggggt
acatctgctgtgattaatacggtcaactggatcgagtcgtcttcgtgggatggaagagat
ggtattgttgtctgtggtgacattgccatctattcgaagggagccgctagacctaccggg
ggtgctggtgccgttgcgttgttgattgggccagatgcaccaattgtgtttgaatccacc
aggggctcgtttatggaacacgcttacgatttctacaagccagatttcacttctgaatac
cctatagtcgacggacacttttcgttagcatgttacgtcaaggctgttgaccagtgttac
aagaactactccaagaaggttaccaaggatgacaataagactgttggtgttttcgaccat
tttgactacaacgcgttccacgtcccaacctgtaagttggtcaccaagtcgtacgccaga
ttattgtacaatgactacaaagcggacccatctaagtttaaggacttgattgatgaagaa
accaagaaatcaatcgatagcttaacttacgaccaatctttggttgacaagaacttggaa
aagatctttgttggattagccaaggaacaaaccaagaccagagttcaaccatgtttgaat
gttccaaccaacaccggtaacatgtattctgcatccgcatgggcttcgttatcctcatta
ttgtactatgttggttccgaacaattgcaaaacaaaagaatcggtgtcttctcatacggt
tctggtttagcctccaccttattgtctgttgttgttaagggtgatatttctaaaatcacc
aagaatttggacttcgaccacaaattgtctgaaggtagagttactagaaccccagagcaa
tatcttgaagctatcgaattaagagaaaaggctcatttacaaaagtcattcaagccatct
ggtagtatcgaaactctcgctaggggtacgtactatttgactgaaatcgatgataagtac
agaagacaatataataaaaaggattaa

DBGET integrated database retrieval system