KEGG   Debaryomyces hansenii: DEHA2A03014gHelp
Entry
DEHA2A03014g      CDS       T01026                                 

Definition
DEHA2A03014p
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dha  Debaryomyces hansenii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DEHA2A03014g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     DEHA2A03014g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:256577..257491
Genome map
AA seq 304 aa AA seqDB search
MEDKRELLKQPLHGIYIPILLMLVGTLIFGVEYLPYTIAIIVVVCSVKFYESYSKRSSMD
TLKWKEFELIDKTIVSRNSAIYRFKLKNDDEVLNITPGHNVACCMEIDGKDEIRYYSPIS
NQFDTGFFDILVKSYPTGKISKRFAMLREGQTVKFRGPVGRLEYKTNMAKEIGLIAGGSG
ITPILQVITEIITNPEDQTKISLIFANETHNDILLKSEIDEIAKRYPNFDVHYTLTHAPT
GWEGSTGFVTKEMVQKHMPSPDAQNKLFICGPPEMKRSLIDISAELGWEKGVMKSATEDQ
VFCF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagataaaagagaattattaaagcagccgttacacggtatttatataccaatcttg
ttaatgttagttggtactttaatttttggtgttgagtatttaccgtacactattgccatt
atagtagttgtttgcagtgtcaaattttatgaatcttactccaagagactgtcgatggac
accctcaaatggaaagaatttgagttgattgacaagactattgtttcaagaaactctgct
atttataggttcaagttgaagaatgacgatgaggtattaaatattacaccgggacataat
gttgcatgttgtatggaaatcgacggaaaggacgagattaggtattattcaccaatatcc
aatcagttcgataccggattctttgacatcttggtcaagtcttatcctactggtaagatt
tccaagagatttgccatgcttagagaaggacaaaccgtcaaatttagaggaccagtaggt
agattagagtacaagaccaatatggctaaggagataggattaattgctggtggttctggt
atcactccgatcttgcaggttattactgaaattatcactaatcccgaagatcaaaccaag
atttccttgatttttgccaacgaaactcataacgatattttattgaagagcgaaatcgat
gaaattgctaagagatatcctaatttcgatgttcattacactttgactcatgctccaact
gggtgggaaggtagtactgggtttgtgacaaaagaaatggtccaaaaacatatgccatct
ccagatgctcaaaataagttattcatttgtggccctccagagatgaagaggtctttgatt
gacatttcagccgaattgggttgggaaaagggtgttatgaagtcggctacagaggaccaa
gttttctgtttctga

DBGET integrated database retrieval system