KEGG   Debaryomyces hansenii: DEHA2A04510gHelp
Entry
DEHA2A04510g      CDS       T01026                                 

Definition
DEHA2A04510p
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dha  Debaryomyces hansenii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DEHA2A04510g
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    DEHA2A04510g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     DEHA2A04510g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:367586..370390
Genome map
AA seq 934 aa AA seqDB search
MLSSKNDHSVDENSDLLELSDSISPSDISNHSFYGNFKRSSSLPIQSNLPTLFNNLRAND
RKESSNSGTSPGRSWLRKLMSPSNKLNDLGSMENTKPGWAGKNANSKSLGDNTNSEEDSY
DISLDNERETSAYPFKDIDQVKIPPVFFKEGLSLLKVSHKSKKRTFFQIGEKDFQFSLKN
AYASASTTASSGLYRLLTPTSSYQPKNKSYEFSIDDIKAISYQKDASNYRKELHVSKEFE
SQWLTIIYFDKKKKKLKTIHVIADTEHDLKKLLSVLSGLKKLRNNLAKNYLLDLNDIDET
QRNMFIGRSQEENEKEIRKFLSFNDILKYSKRLNINMNPTYLRTIFNFVCADSSVDRGLD
FDQFKQFVSILKTRHDITHIWNSTCGENKSMTFDIFKNFMTDVQKESFTEEYLRKIFRKF
CIEDKNYWIPENFNNFLLSKYSTSMYNAATNESYFDHPLNEYFISSSHNTYLMGRQVAGD
SSIEGYIKALQRGCRCVEVDIWDGYIDGMDDNDKTNNEPIVSHGRTFTSSISLNNVFKTI
KKYAFITSPFPLIISLEINCSIDNQLKVVRTLKEVLGDTLITQPIDDKFTLPTPLQLKHK
ILLKVKKTSPFSDLIASENGNYVSSTTTTTTSFSEDNGSGGVKRRSSFSIRRRKARKITD
TLSDLGIYLQGVKFRNFSLPESKTFNHCFSLSEKSINTMLKDDIKCTSIDKHNRKYFMRV
YPSNIRLKSSNFLPMKYWSHGVQMVATNWQTYDLGQQINESLFESTNRRGYVLKPEDLRK
PLLKSSNRSIVAKRTIKTKFDIEIISAHQLPKPKGSVSAINPFINFDITGASDIVWDRGS
APLRTSIIPENGFNPIWNEKFSGTITTFDDFVFVRFLINASSSISEVEEIQPIGILVCKL
FDLKKGYRYLPINDLLGEELIYSTLFVKINYYEL
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgctttcatctaagaatgatcattcagttgatgaaaattctgatttattagaattatcg
gattctattagtccttctgatatctcaaaccattctttttatggtaattttaaacgttcg
agctcattgccaatacaatccaatttacctacgctatttaataatttgagggcaaatgat
agaaaagaactgtccaatagtggtacttcgccaggaaggagttggttaaggaaattaatg
agcccaagtaataaattgaatgacttgggttctatggaaaatacaaaaccaggatgggcc
ggaaaaaatgctaatagtaaatcattgggggataatacgaatagtgaagaggactcatat
gatatctctctcgataatgagagagaaacaagtgcatacccgttcaaggatattgatcaa
gtcaagataccgccggtattctttaaagagggtctctcattgcttaaagtatctcataaa
tctaaaaaaaggacattttttcaaataggagagaaagacttccaattttctttgaaaaat
gcatatgcatcggcctccaccacagcttcaagtgggttatataggcttcttacccctaca
tcatcttatcaaccaaaaaataaatcctatgaattctcaattgacgatataaaagccatt
tcgtatcaaaaagatgccagcaattatcgtaaggaacttcatgtatcaaaggaattcgaa
agtcaatggcttacaattatttattttgacaagaagaagaaaaagttgaagactattcat
gttattgctgatacagaacacgatctaaaaaagttattgtctgtattgtcagggttaaag
aagttgagaaataatttggcgaagaattatctcctagatttgaacgatattgatgaaact
caaagaaatatgtttatcggtagaagtcaagaagagaatgaaaaagagattaggaaattt
ctttccttcaatgatatattaaaatattccaaaaggctaaacataaatatgaatccaacc
tatttaaggacaatttttaattttgtatgtgccgacagttctgtcgatagagggttagac
tttgatcaatttaagcaatttgtgtcgatattgaaaacaagacatgatatcactcatata
tggaattcaacttgtggtgaaaacaaaagtatgacctttgatattttcaagaatttcatg
acagacgttcagaaagaaagctttacagaggagtacttgagaaagatatttaggaaattc
tgtattgaagacaagaactattggatacctgaaaattttaataatttcttattatcaaag
tattccacatcgatgtataatgctgcaacaaacgaaagttactttgatcaccctttgaat
gaatactttatatcatcttcccacaatacatacttaatgggtcgacaagttgcgggggat
tcatcaattgaaggttatataaaagctttgcagaggggatgtaggtgtgtcgaagttgat
atatgggatggatatatcgatggtatggatgataatgacaaaacaaataacgaacctata
gtcagtcacggtagaacattcactagttctatttcattgaataatgtgttcaaaactata
aagaagtatgctttcattacctcaccgtttcctttaataataagtctcgaaataaattgc
tctattgataaccaacttaaagtggttcgaacactaaaggaagtgttaggtgatactcta
atcacgcaacccattgatgataagtttactttgccaaccccattgcagttgaagcacaaa
attttattgaaagtcaagaagactagtcctttcagtgatcttattgctagcgaaaatgga
aattacgtttcttcgaccactacaaccacgacatcattcagtgaagataacggatcgggt
ggagttaaaagaaggtcttctttcagtattaggaggagaaaggcaaggaaaatcactgac
acgctaagtgatttagggatttatttgcagggcgtaaaattcaggaatttttcattacct
gaatcaaaaacgttcaatcactgtttttcattgagcgagaagtcaattaacaccatgctt
aaggatgatattaaatgtacttcgattgataaacataacaggaaatacttcatgagggtt
tatccatcgaatataagattaaaatcgtcgaattttttgccaatgaaatattggtcgcac
ggagtacaaatggtggctacaaactggcagacttatgacttaggtcagcaaattaatgaa
tccttatttgaaagcaccaatagaaggggatacgtattaaaacccgaggatttacgaaaa
cctctattaaaatcatctaatagatccatagtcgcaaaacgaacaattaaaacaaaattt
gacatagaaataattagtgcccaccaactccctaaaccgaaaggatcagtatctgctata
aacccctttatcaattttgatataactggagctagcgatatagtatgggatcgtggatca
gctcctttgagaacttcaataattcctgaaaatggatttaatcctatatggaacgaaaaa
ttcagtggtactattactacattcgatgacttcgtttttgtgaggtttttgatcaatgca
tcttcttcaatttcagaggtagaagaaatacagcctataggtatcctagtttgcaaatta
ttcgatctcaagaagggttacagatatcttccaataaatgatttattaggggaggagtta
atatattctacattatttgttaagattaattattacgagctatag

DBGET integrated database retrieval system