KEGG   Debaryomyces hansenii: DEHA2A05654gHelp
Entry
DEHA2A05654g      CDS       T01026                                 

Definition
DEHA2A05654p
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dha01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dha00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dha00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dha00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:470311..471714
Genome map
AA seq 467 aa AA seqDB search
MSALIAASRSTMAFRAVACTKQYSAGYLQLARLYSSGKFPPHTVINMPALSPTMTQGNIG
SWSKSVGDELHAGEAIAEIETDKASMDFEFQEDGYLAKILLGDGTKDVPVGKPIAVYVEE
SEDVQAFESFTAEDAGDASTEAKAPEPEKESKAEESKPEASEKKSKSESAPAQSKPVAGR
IFASPLAKTIALDKGIALKNIKGSGPNGRIVAKDVENFKAPAAAAAAAPSATAAAYEDVP
ISNMRKTIATRLTQSTQESPSYIVQSQISVSKLLKLRQSLNAAADGRYKLSINDLLIKAI
ALANLRVPEANSAWLLDQGVIRTYSNVDVSVAVATPTGLITPIIKNAHTKGLSAISNEIK
ELGKKAKAGKLAPEEYQGGTITISNLGMNHAVNSFTSIINPPQSAIVAIGTVDKKAVPSN
VNEQGFVFDDVMTITGTFDHRTVDGALGGEWIKALKTIVENPLEMLV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttaatcgctgcgtcaagatctaccatggccttccgtgccgttgcttgtact
aaacaatacagtgcagggtatttgcaattagcaagattatattcatcagggaaatttcct
cctcataccgtgatcaatatgccagcgttatcaccaacaatgactcaaggtaacattggt
agttggagtaagagtgtcggtgacgaattgcacgcgggagaagcaattgctgaaattgaa
actgataaggcctcgatggactttgagtttcaagaggacgggtacttggccaagattttg
ttaggagacggaaccaaggatgttccagtgggtaagccaattgctgtgtacgttgaagag
tcggaagatgtgcaagctttcgaatctttcaccgcggaagatgctggcgatgccagcact
gaggccaaggcaccagaaccggaaaaggaatccaaggcagaggaatcgaagccagaagcc
agcgaaaagaaatcgaagtccgaaagcgctccagctcaatccaagccagttgcgggtaga
atttttgcttctccattggccaagaccatcgcgttggacaagggtatcgctttgaagaac
atcaagggttcaggaccaaacggtagaattgtggccaaggatgttgaaaacttcaaggct
ccagctgctgctgctgctgctgctccatcggccaccgctgctgcttacgaagatgttcca
atctcaaacatgagaaagaccattgctaccagattaacccaatccacgcaagaatctcct
tcatacatcgttcaatcgcaaatttctgtttctaagttgttgaagttacgtcaatctttg
aacgccgctgctgacggtagatacaagttatcgatcaacgacttgttgatcaaggctatt
gcattagccaacttgagagttccagaagccaactcggcctggttacttgaccaaggtgtc
attagaacctactccaacgtcgatgtttctgtcgctgttgccaccccaactggtttaatc
actccaattatcaagaatgcccacaccaagggtttgtctgctatctcgaacgaaattaag
gaattaggtaagaaggccaaggctggtaagttggctcctgaagaataccaaggtggtacc
atcaccatctctaacttaggtatgaaccacgccgtcaacagcttcacctcgattattaac
cctcctcaatcagctatcgttgctatcggtactgtcgacaagaaggctgttccatctaac
gttaatgaacaaggtttcgtctttgatgatgttatgaccatcaccggtactttcgaccac
agaactgtcgatggtgcccttggtggtgaatggattaaagcattaaagactattgtcgaa
aatcctttagaaatgttagtctaa

DBGET integrated database retrieval system