KEGG   Debaryomyces hansenii: DEHA2A05654gHelp
Entry
DEHA2A05654g      CDS       T01026                                 

Definition
DEHA2A05654p
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dha  Debaryomyces hansenii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DEHA2A05654g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DEHA2A05654g
   00020 Citrate cycle (TCA cycle)
    DEHA2A05654g
   00620 Pyruvate metabolism
    DEHA2A05654g
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DEHA2A05654g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:470311..471714
Genome map
AA seq 467 aa AA seqDB search
MSALIAASRSTMAFRAVACTKQYSAGYLQLARLYSSGKFPPHTVINMPALSPTMTQGNIG
SWSKSVGDELHAGEAIAEIETDKASMDFEFQEDGYLAKILLGDGTKDVPVGKPIAVYVEE
SEDVQAFESFTAEDAGDASTEAKAPEPEKESKAEESKPEASEKKSKSESAPAQSKPVAGR
IFASPLAKTIALDKGIALKNIKGSGPNGRIVAKDVENFKAPAAAAAAAPSATAAAYEDVP
ISNMRKTIATRLTQSTQESPSYIVQSQISVSKLLKLRQSLNAAADGRYKLSINDLLIKAI
ALANLRVPEANSAWLLDQGVIRTYSNVDVSVAVATPTGLITPIIKNAHTKGLSAISNEIK
ELGKKAKAGKLAPEEYQGGTITISNLGMNHAVNSFTSIINPPQSAIVAIGTVDKKAVPSN
VNEQGFVFDDVMTITGTFDHRTVDGALGGEWIKALKTIVENPLEMLV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttaatcgctgcgtcaagatctaccatggccttccgtgccgttgcttgtact
aaacaatacagtgcagggtatttgcaattagcaagattatattcatcagggaaatttcct
cctcataccgtgatcaatatgccagcgttatcaccaacaatgactcaaggtaacattggt
agttggagtaagagtgtcggtgacgaattgcacgcgggagaagcaattgctgaaattgaa
actgataaggcctcgatggactttgagtttcaagaggacgggtacttggccaagattttg
ttaggagacggaaccaaggatgttccagtgggtaagccaattgctgtgtacgttgaagag
tcggaagatgtgcaagctttcgaatctttcaccgcggaagatgctggcgatgccagcact
gaggccaaggcaccagaaccggaaaaggaatccaaggcagaggaatcgaagccagaagcc
agcgaaaagaaatcgaagtccgaaagcgctccagctcaatccaagccagttgcgggtaga
atttttgcttctccattggccaagaccatcgcgttggacaagggtatcgctttgaagaac
atcaagggttcaggaccaaacggtagaattgtggccaaggatgttgaaaacttcaaggct
ccagctgctgctgctgctgctgctccatcggccaccgctgctgcttacgaagatgttcca
atctcaaacatgagaaagaccattgctaccagattaacccaatccacgcaagaatctcct
tcatacatcgttcaatcgcaaatttctgtttctaagttgttgaagttacgtcaatctttg
aacgccgctgctgacggtagatacaagttatcgatcaacgacttgttgatcaaggctatt
gcattagccaacttgagagttccagaagccaactcggcctggttacttgaccaaggtgtc
attagaacctactccaacgtcgatgtttctgtcgctgttgccaccccaactggtttaatc
actccaattatcaagaatgcccacaccaagggtttgtctgctatctcgaacgaaattaag
gaattaggtaagaaggccaaggctggtaagttggctcctgaagaataccaaggtggtacc
atcaccatctctaacttaggtatgaaccacgccgtcaacagcttcacctcgattattaac
cctcctcaatcagctatcgttgctatcggtactgtcgacaagaaggctgttccatctaac
gttaatgaacaaggtttcgtctttgatgatgttatgaccatcaccggtactttcgaccac
agaactgtcgatggtgcccttggtggtgaatggattaaagcattaaagactattgtcgaa
aatcctttagaaatgttagtctaa

DBGET integrated database retrieval system