KEGG   Debaryomyces hansenii: DEHA2A06006gHelp
Entry
DEHA2A06006g      CDS       T01026                                 

Definition
DEHA2A06006p
Orthology
K14298  
mRNA export factor
Organism
dha  Debaryomyces hansenii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DEHA2A06006g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(497474..498586)
Genome map
AA seq 370 aa AA seqDB search
MSFLSSNTAASTTNTSASNGQELINDITINNPPEDSISDIAFSPQQDLLVAASWDKKVRI
YEIDPNTGNNQGRAMFEHEAPVFSARWSIDGTKVISGGADKQVKLFDIASQQTQQIGAHD
APVRAVRFVECGPTNTQVVVSGSWDKTLKYWDMRAPQPVSTVNLPERVYCMDSSQKLLVV
GCAERQISIIDLNNPQQIFKNSMSPLKWQTRSISCYPQGNGFAVGSIEGRCAIQYIDESE
QSKFGFSFRCHRKTPTGANTTSALRTSANSESHIYSVNSIAFHPVYGTFSTAGSDGTFCF
WDKDAKQRLKTFPAVNCTIPATCFNKNGTIFAYAMSYDWSQGHTGNKPDYPNQIKLHATK
DEEIKQKKKR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttttaagcagcaatactgccgcatccaccacaaatacaagtgcatccaatggt
caggaattgatcaatgatatcaccattaataatccgccagaagactcgatatcagacata
gcgttctcaccccaacaggatttgctagtggcggctagttgggacaaaaaggtccgaatc
tacgaaattgaccccaatacgggtaataatcagggccgggctatgtttgagcacgaggcg
cctgtttttagtgccagatggtctattgacggtaccaaggtgattagtggaggagctgat
aaacaggtgaagttgttcgatatagcctcgcaacagacacaacagataggggcacatgat
gcgccagtaagggccgttcgctttgttgaatgtggccctacgaacacgcaagtggtcgtt
tctgggtcgtgggacaagacgttgaagtactgggatatgagagcaccccaaccggtatct
actgttaacttgccagaaagggtctactgcatggactcgtcacagaagttgttggttgtg
gggtgtgctgagagacaaatcagcatcattgacttgaacaacccgcaacagattttcaaa
aactcgatgtcccccttgaaatggcaaaccagatccataagctgctacccacaagggaat
ggtttcgctgtcgggtccatcgaaggaagatgtgcgatccagtatattgatgagagcgaa
caaagtaagtttggcttctcgtttagatgtcaccgtaagactcccaccggggccaacacc
acgtcggcgttgcgtacatctgccaactcagaatctcacatctactccgttaactctatt
gcattccatcctgtctatgggactttcagcacggctggttccgatggaactttctgtttc
tgggacaaagatgcaaaacaaagattgaagaccttccctgctgtcaactgcaccataccg
gccacttgtttcaacaaaaacggaaccatattcgcctacgctatgagttacgactggtct
caaggccataccggtaacaaaccagattaccctaaccagatcaagttacatgctaccaaa
gacgaagagatcaaacaaaaaaagaaacgttag

DBGET integrated database retrieval system