KEGG   Debaryomyces hansenii: DEHA2A07194gHelp
Entry
DEHA2A07194g      CDS       T01026                                 

Definition
DEHA2A07194p
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dha  Debaryomyces hansenii
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DEHA2A07194g
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    DEHA2A07194g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     DEHA2A07194g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:585306..586220
Genome map
AA seq 304 aa AA seqDB search
MQSELLDSSYGKGNVKFLKVKKNPHNSKEQDVLEANVQVLLKGNFDVSYTKADNAPIVPT
DTVKNTILIEAKTTNVWPIERFAAHLAKHFTEKYAHVSGIEVSIVQSKWTKYEVDGKIHP
HSFKHEGPETRRTFLTYCRSNKKLTITSSIKDLTVLKSTGSMFYGYNVCDYTTLKPTKDR
ILSTDVDASWTYDPKQVTSLDQVLTQADKGLFDSTYDSARKVTLDLFALENSASVQATMY
NMSHKILELVPEVGTVSYALPNKHYILFNLEWKGIKQNDELFYPSPDPNGLIKSTVGRKT
QSKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcagaattgttagactcctcatacggcaaaggaaatgttaagttccttaaagtt
aaaaagaacccccataattctaaagaacaagacgtattagaagcaaatgtccaggtgtta
ttgaagggtaattttgatgtttcatatactaaggccgataatgcccctattgttcctaca
gatactgttaagaatactatcttgatcgaagccaaaaccactaatgtgtggccgattgaa
aggtttgcggcccatttggcgaaacatttcactgagaaatatgcccatgtttctgggatt
gaggtgagcatagttcagagcaaatggaccaaatatgaggtggatggtaagatccatcca
cattcctttaaacatgaaggtccggaaacgagaagaacgttccttacttattgcagatcg
aataaaaagttgacaattacttcttcgatcaaagacttaactgttttaaaatccactggt
tctatgttctacggttataacgtttgtgattacactacattgaagcctaccaaggacaga
attttatctactgatgtagatgcatcttggacatatgatccaaaacaagttacatctttg
gaccaggtattaactcaagctgataagggcttatttgactctacttatgatagtgccaga
aaagtcacattagacttgtttgccttggaaaattctgcatctgttcaagctactatgtac
aatatgtctcataagattttagaattggttcctgaagttggaaccgttagctatgccttg
cctaacaagcactatatattattcaacttggaatggaagggtatcaaacaaaatgatgaa
ttattttatccttctccagatccgaatggtcttataaagagtaccgttggcagaaagacc
cagtccaagttatag

DBGET integrated database retrieval system