KEGG   Debaryomyces hansenii: DEHA2A07942gHelp
Entry
DEHA2A07942g      CDS       T01026                                 

Definition
DEHA2A07942p
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DEHA2A07942g
Peptidases [BR:dha01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DEHA2A07942g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(653958..656588)
Genome map
AA seq 876 aa AA seqDB search
MSTSSNTSNSGPNRFRSDAASFSPSVPSPGVMNQQMQQQQHIYPQYMYGTPQMVPNQYYP
YMTPYMMHPNAPYSDFNPYTQAYGGYPMQMPQYPGQPYPGMPNMSGGGNMNMNAMMNNRP
KMNHNNKSKPYISNSNRSRSSSTVSSNVPNQYQHHQQTPPVSHPHPHPHPQDQWKHENKP
ENPADEKAQTDQRKSDTSSSTDTNHETSKQVKKHVTLESTTKKGQEKTPSTSSNKPMSYP
LYFNETAQDFIKSQQSIASERNQLVKQKNERLNEFIRSENNEKQSLVINRNSNITIIDYN
TNTTHKTIENNNYNTHRPNDNDDNNSNKFNDNSNEVDLEGEDSTDINKDNKSANWASFLQ
TTATVPAKKSKSQPKPSTGPSQISASSSTTGISPSTNNTQVNNILALDSSQPLGILMLKI
MFDNNYSVMNSYNNCPIFRVKPRGLTNTGNICYMNAILQVLLYCEPFNKTLKLVESKSIG
SLSQKSTTPLLDIVIKFWKEFSQPSSMKPISPDNFYMSLITHEKFSHLKWGQQEDAEEFL
GYFLDGLHEEFVGSIKGLNTPQTDLLIQQFQQQNEDIDQLKLNAFKLNIKNTMKIIKKSK
SENQDTTHQEEVSDHESNGWSEVGSNNKKISAKRTVEIEPSPITTIFGGQFRSVLQIPKN
KESQSITLDPFQCIQLDISDSSITTVEDAFKQLNEPENIPYKSSSNKEVIAKKQTFIDQL
PNILIIHLKRFSYQQEKEKESTPSNEQSSNTSSNGSRPLGSIEKLRKKIEYSHHLTIPNE
VLSPLYKHSGNISNHYKLFGVVYHHGVSAEGGHYTSDVLRKSSVFDNEEESNDKKVDNQW
IRIDDTQITELEKDEVLNGGDEETTKNAYILFYQKT
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatcttcgaacacatcgaatagtggccccaatcgtttccgcagcgacgctgct
agcttttcaccgagtgttccttctccgggagtcatgaaccagcaaatgcaacaacaacaa
catatataccctcagtacatgtatgggacaccacaaatggtacctaaccagtattatcca
tatatgacaccgtatatgatgcacccgaacgcaccgtactcagacttcaatccatatact
caagcgtacggagggtacccaatgcaaatgccacagtatccggggcagccatatccagga
atgccaaacatgagtggaggaggaaatatgaacatgaatgcaatgatgaacaacaggcct
aaaatgaaccataataataaatccaagccgtacatatctaattcgaataggtcaaggtcc
tcgtcgacagtttcgtcgaacgtcccaaaccagtatcaacatcaccaacagaccccgcca
gtttcacacccacacccacacccacacccacaagatcaatggaaacatgaaaataagcca
gagaatccggccgacgagaaagcacagactgaccagcgtaaatcggatacctcatcgtct
acagataccaaccatgaaaccagcaaacaagtgaagaagcatgtcactttagagtcaact
acaaagaagggtcaagagaaaacaccatcgacgtcttctaacaaaccaatgtcttatcca
ttatatttcaacgaaaccgcccaggactttattaaatcacaacaatcaatagcgtctgaa
agaaatcaattagtgaaacagaaaaacgaaagattgaacgaatttatcaggtcagaaaat
aatgaaaagcaaagcttagtaattaatagaaatagtaatatcacaattatagattacaat
accaatactactcacaaaactattgagaataataattacaatactcatagacctaatgat
aatgatgataataatagtaataaatttaatgataacagtaatgaagtcgatcttgaaggg
gaagattcaacagatataaataaagataacaagtccgctaattgggcttcatttttacaa
acaacagcaaccgtaccagccaagaaatcaaagtcacaaccgaaaccttctacaggacct
agccaaatatctgcttccagttcaacaacaggtattagtccttccacaaacaatacacag
gtaaacaatatattagctttagattcttctcaaccgctaggaattttaatgttgaagata
atgtttgataataattactcagtaatgaactcttacaataattgtccaattttccgcgta
aagcctagaggattgaccaacaccgggaatatatgttacatgaatgcaatcttgcaagtt
ttattatattgtgaaccatttaataagactcttaagttagttgaaagtaaatccattggc
tccttaagccaaaaatcaacaactccgttattagatatagtgattaaattctggaaggag
tttagtcaaccatcgagcatgaaaccgatttctccagataatttttatatgagtttgatt
acacatgaaaaattctcacatttgaaatggggtcaacaggaagatgccgaagaattctta
ggatacttcttggatgggttacacgaagaatttgttggatcgattaagggattgaacacc
cctcaaactgatttattaattcaacaattccaacagcaaaacgaagatattgatcaactc
aaattaaatgcattcaagttgaatattaagaatactatgaaaatcattaagaagtccaag
ctggaaaatcaagacaccactcaccaggaagaagtctctgatcatgaaagtaatggttgg
tcagaggtaggatccaacaacaagaaaatcagcgctaagagaaccgttgaaattgaacca
tctccaataacaacaattttcggaggtcaatttagatcagtattacaaatacctaaaaat
aaagaaagccaatcgatcacattggatcctttccaatgtattcaattggacatttcagac
tcctctatcactactgttgaagatgcattcaagcaattgaatgagccagagaacattccg
tacaagtcttcttctaacaaagaggttattgctaagaagcaaacttttattgatcaattg
cctaatattttaataattcatttgaagagattctcataccagcaagaaaaagagaaagaa
agcactccatctaacgagcaatcatcaaatacatcatcaaatggttcaagacctttggga
agtattgaaaagttacgtaagaaaatagagtactctcatcatttgacaatccctaatgaa
gttttatctccattatataaacattcaggcaacatcagtaaccattataaattattcggt
gttgtataccatcatggtgtcagtgcagaggggggccattataccagtgatgtattgaga
aaatcatcggttttcgataacgaggaggaatcgaatgataagaaggttgataatcaatgg
ataagaattgatgacacccaaattactgaacttgaaaaagatgaagtattgaacggcggc
gacgaagaaacgacgaagaatgcatatatattattctatcagaagacctaa

DBGET integrated database retrieval system