KEGG   Debaryomyces hansenii: DEHA2A09856gHelp
Entry
DEHA2A09856g      CDS       T01026                                 

Definition
DEHA2A09856p
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
dha  Debaryomyces hansenii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DEHA2A09856g
Enzymes [BR:dha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     DEHA2A09856g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(829411..830565)
Genome map
AA seq 384 aa AA seqDB search
MSSSSQTKPVDTSPIIKKHNEKYHNSYLAMVERNQIPLSRALLCGIHLFNYIFPGGFASK
FIRLQHRTGTSYSGSALYDIGIDDGYYIVHWVILLTFLRSFLMQWCFEPFASYFCNIHSR
KAKVRFSEQSWSFVYYSFSFTYGAYLYYNSSYWLNFDQIFANWPHYQLGSLFKKYYLISM
GFWLQQIFVLNIEERRKDHFQMFSHHIITCLLLTGSYYYYYNRIGHLILMIMDSVDIFLA
AAKLLKYSGYNNACDYMFVFFMVSWVVLRHGLYNYLFYQSWHNASSLMSNSECIPGQFQK
RCWTPTILNSFFFLLGGLQVITMIWMYLISKVAYKVISGKGAEDVRSDEDDSDYEEDSNI
APDGHHSSNKRRDYPNIGSDINIK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatcatctcagactaaaccagttgacacatcaccaattatcaagaaacacaat
gaaaaatatcataattcatatttagctatggtcgagaggaaccaaataccgttgtctcga
gcgcttttatgtggtatacacctatttaactatatctttccaggagggtttgcatcgaaa
tttattcgcttacagcaccgaacaggtacttcgtacagtgggagtgcattgtacgatatt
gggatcgacgacgggtattatattgttcactgggttatattgctaacgtttcttagatcg
tttctcatgcagtggtgctttgaaccatttgcctcatacttctgtaatattcattctaga
aaggctaaggtgagattttccgaacaaagttggtcgtttgtatactattcattttctttc
acatatggtgcttatttatattacaactcgtcatactggctcaatttcgatcagattttc
gcaaactggccgcattatcaactagggtcgttattcaagaaatactacctcatttctatg
ggattctggttgcagcagattttcgtgttgaatattgaagaaagaagaaaggatcatttc
cagatgttcagtcaccatataattacgtgtttgttgctcactgggtcatattactattat
tataatagaatcggtcatttaatcttgatgattatggattcagtagacatattcttagca
gctgcgaaacttttgaaatattcgggttacaacaatgcctgtgactatatgtttgttttc
ttcatggtttcgtgggtagtgttgaggcatggcctttacaattatttattctaccagagt
tggcataatgcatcgagtttaatgagcaattcagaatgtattccaggtcagtttcaaaaa
agatgctggacgccgacaattcttaatagtttcttttttttgttaggtggtttgcaggta
atcacaatgatctggatgtaccttatttcgaaggttgcctacaaagttattctggggaaa
ggagcagaagacgttagaagtgatgaagacgatctggactacgaagaagatagtaatata
gcgcctgatggccaccattcttcgaataagagaagagactatcctaatatcggaagtgac
attaatataaagtaa

DBGET integrated database retrieval system