KEGG   Debaryomyces hansenii: DEHA2A12254gHelp
Entry
DEHA2A12254g      CDS       T01026                                 

Definition
DEHA2A12254p
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
dha  Debaryomyces hansenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DEHA2A12254g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DEHA2A12254g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:1034993..1036630
Genome map
AA seq 545 aa AA seqDB search
MMKLNLIISMLIANFAVSYGLYVPGYDLHYLNTGVAEAVQKVLSLNLFPNYDDKVDSSDT
TEQSEYEKWLVTQGNTSFQGILNNIGGISEFLEGTEVSEGAVIASPSKNKPNYFYQWVRD
AALTIRSLVHYLEDNNTNNQKICSIIEKYIENNYYLQRLPNNSGRFDDNTRSGLGEPKFM
PDCTAFDEHWGRPQNDGPGLRISTIVSYLNLIEKYRLSLSNKFLKDERFIYDEIIKPDLF
YIVKNWKKESFDIWEEVNSIHFFTSMSQLRAVIDGLKLAKKYEVDKQFVDQLYESITNLK
SFIEVDARFAIPSSLYIIETPGLFSSGKRSGLDAAALLASIHSHDLEVDEYSDVPFDVND
YHILNTINAMASDMRFRYPINRDRIGKPSLGVALGRYPEDIYDGVGSSEGNPWFIATASA
AEVIFKTVYKLSDSQQDLLINKYNQEFFKSFINFEADDLEEFVIPCNSIRYNNALLNLFD
FGDSFLKIIKDHVDGNGHMSEQFNKYTGYMQGAMDLTWSYSAFWNALRWRNKTLEVISNH
NNNHN
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagttaaatttgattatactgatgcttatagcaaattttgctgtttcttatgga
ctttatgtgcctgggtatgaccttcattacttgaatactggtgtggctgaagcagtacaa
aaggttttatccttaaatctatttccaaattacgacgacaaagtagattcactggatacc
acagaacaatctgaatatgaaaaatggttagtaactcaaggaaatacttcgtttcaagga
attttgaataatattggaggcattagtgagttcctagaaggaacggaggttagtgaaggg
gcagtcattgcatctccttcaaagaataaaccaaattatttctaccaatgggtcagagat
gctgcattaaccattcgatccttggttcattatcttgaggacaacaatactaacaaccag
aagatatgttccataattgaaaaatatattgaaaataattactacttgcaaagattaccg
aacaatctggggaggtttgatgataatactcgatcaggtttaggagaaccaaaatttatg
cccgattgtacagctttcgatgagcattgggggagacctcaaaatgatgggccaggatta
agaatttcgacaattgtttcctacctaaatttaatagaaaagtatagactaagcttgtct
aataagtttttaaaagatgaaagatttatatacgacgaaatcattaaaccagatttattt
tatattgttaaaaattggaagaaggagagttttgacatttgggaagaagtcaattctatt
catttctttacatctatgtcccaattgagagctgttatagatgggctcaagttagccaag
aaatatgaagtagataaacagtttgttgaccaattgtatgaatctatcaccaacttgaag
ctgtttattgaagttgacgcaagatttgctatcccatcatctctttatattattgagaca
ccaggcttattttctagtggtaaaagatcaggactagatgctgctgctttactcgcaagt
atacattcacatgaccttgaagttgatgaatactctgatgtaccgtttgatgttaatgac
tatcacattttaaatacgattaatgcaatggcttctgacatgaggtttaggtatccaata
aaccgtgatagaataggaaaaccttcacttggtgttgcgctaggcagataccctgaggat
atttatgatggagtagggtcatcagagggtaatccatggtttatcgcgactgcgtcagca
gcagaagttatttttaaaacagtttacaagctactggacagtcaacaagatttattgatt
aacaaatataatcaagaattctttaagtcattcattaactttgaagccgacgatttagaa
gaatttgtcattccgtgtaattccatccggtacaacaatgcgttacttaatttatttgac
tttggtgactcctttttgaagataataaaagaccatgttgatggaaatggtcatatgtct
gaacaattcaataaatatacgggctacatgcaaggtgctatggacctaacttggagttat
agtgcattctggaatgctttgaggtggagaaataagacccttgaagtcatatccaatcac
aataataatcataattag

DBGET integrated database retrieval system