KEGG   Debaryomyces hansenii: DEHA2A13838gHelp
Entry
DEHA2A13838g      CDS       T01026                                 

Definition
DEHA2A13838p
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dha  Debaryomyces hansenii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DEHA2A13838g
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DEHA2A13838g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     DEHA2A13838g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(1160622..1161896)
Genome map
AA seq 424 aa AA seqDB search
MSDSKSYIIVIKLGTSSLVDEVTREPRIANMSLIVETIVKLRRQGHKIVLVSSGAIAFGM
KRVGISSKPSKLAAVQALASIGQGRLIGLFDDLFRQMEQTIGQILLTRNDISDFNQYKNA
KNTLHELLDMGVIPIVNENDTLSVAEIKFGDNDTLSAITAGMVHADYLFLMTDVQCLYTD
NPRSNPDAEPILVVDKVDDLDVKTDTESGGSKVGTGGMTTKLIAAGLATNVGVTTIITLS
SQPDSILSIVSNIQSMDKLDLSTEQQTRYIAGEIKKNKIPLHTRFLGLPRATKIISDKRF
WLLHGIKTKGTLYIDHLCYEALTRKDRAGLLPVGIVAVEGSFHESECVSIKVIAERSSPL
SDGLEVGTCRVNYSAIEINLIKGLHSSEIEPVLGFADSEYVAHRDNLAFQPTLPPSTESL
FENN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattcaaagtcatatataattgtcatcaaacttgggacctcatctttagtagat
gaggttaccagagaaccaagaattgcaaatatgtcgcttatagtggaaactattgtcaaa
cttcgtcgccagggacacaagatagtccttgtctcatctggggcgattgcgtttgggatg
aaaagggttggtatttctagcaaaccatcaaagttagctgcggtccaagcgttggcatca
attggtcaaggtcgcttaattggattatttgatgatctctttaggcaaatggagcagact
attgggcagattttgcttacaagaaatgatataagtgattttaaccagtataagaatgct
aaaaatacgttacatgaattattggacatgggagtgattccaattgtaaatgaaaatgac
acgttatcagtagctgaaattaaatttggtgataatgatacgctttcggcaattactgca
ggcatggttcatgccgactatttattcttaatgacagacgttcaatgcttatacacagac
aacccaaggagtaatccagatgcagaacctatactagtggtagacaaagttgatgatttg
gacgtgaaaaccgatacagaatcgggcggatccaaagtgggtactgggggtatgactaca
aaattaatcgcagctggattggctactaatgttggtgtcactactataataaccctttct
agtcaaccagactcgattttatctattgtgtcaaatattcagtctatggataagcttgat
ttatctactgaacagcaaactagatatatagctggtgagatcaaaaaaaacaaaatcccc
ctccatacacgcttcttagggttacctcgtgcaactaagataatatcggataagagattc
tggttattacatggtataaaaactaagggaactttatatattgatcatctatgttatgaa
gccttaactagaaaagatagggctggtttacttccagtgggtattgtggctgttgaaggc
agtttccatgaaagtgagtgcgtatcaattaaggtgattgccgaaagatcctctccttta
tctgatggtcttgaagtaggaacctgcagagtgaattatagtgctattgaaataaactta
ataaaaggtttacacagtagtgaaattgaaccagttttgggatttgctgatagtgagtac
gttgcccatagagataatttggcattccagccaaccttaccaccttccactgaatcctta
tttgaaaataattag

DBGET integrated database retrieval system