KEGG   Debaryomyces hansenii: DEHA2A14168gHelp
Entry
DEHA2A14168g      CDS       T01026                                 

Definition
DEHA2A14168p
Orthology
K03259  
translation initiation factor 4E
Organism
dha  Debaryomyces hansenii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DEHA2A14168g
Translation factors [BR:dha03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    DEHA2A14168g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:complement(1185100..1185762)
Genome map
AA seq 220 aa AA seqDB search
MKVFTNKIAKMSEELSKQTEELSLENKDTVLSNKEEFTAKHPLNNKWTLWYTKPQVNKSE
NWHDLLKPVITFSSVEEFWGIYNSIPQANQLPMKSDYHLFKEGIKPEWEDEQNSKGGKWQ
FAFNNRRDVGSIINDLWLRGLLSVIGETIEDDEDEVNGIVLNIRKQVIRIGLWTKDCDET
KLRTVGERLKKILKLSEEQKLDFMSHEDSGKKGAEPLISL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttttactaacaaaatagctaagatgtctgaagaattatctaagcaaactgaa
gaattgtctttagaaaacaaggatactgttttatcgaataaggaagaatttactgccaag
catccattaaataacaaatggactttatggtacaccaagccacaagtaaataaatcggaa
aactggcatgatttattaaaaccagtcatcacattctcttctgtcgaagaattctggggc
atctacaattcgattcctcaagcaaaccaattaccaatgaaatcagattatcatttattt
aaagaaggaattaagccggaatgggaagatgaacaaaactccaaaggtggtaaatggcaa
tttgccttcaacaatagacgtgatgttggatcaatcatcaacgatttgtggttacgtggt
cttttgtctgtcattggtgaaactatcgaagatgatgaagatgaagttaacggtattgtt
ttaaacattagaaagcaagtcattagaattggtctctggacaaaggattgtgatgaaact
aaattaagaaccgtaggtgaaagattaaagaagatcttgaaattatccgaagaacaaaaa
cttgattttatgtcacacgaagactctggtaaaaagggagctgaacctttaatttcatta
taa

DBGET integrated database retrieval system