KEGG   Debaryomyces hansenii: DEHA2A14806gHelp
Entry
DEHA2A14806g      CDS       T01026                                 

Definition
DEHA2A14806p
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     DEHA2A14806g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A:1241713..1243479
Genome map
AA seq 588 aa AA seqDB search
MIKKLFIIAALFATITRASPILKRDLSSNNSSTSYSLDDLCSISHVRESLPSNGTLLGIE
MIPTSVEVNVAESSNYCYCNISVSYAHTGKNDTIVLNYALPDPSTFESRFYVAGGGGYSL
SSSSTGGLSYGAVGGCTDAGYDAFSTSYDEVVLFGNGSINWDATYMFAYQGLGEMTTIGK
ALTSVFYGMSDDEKLYTYFEGCSDGGRQGMSQIQRYGDLYDGAAIGAPAFRYAQQQVNHV
YPSMVEEDLNYFPPPCELSKIINATIGACDSLDGRIDGVISRTDLCMLRFNLSSIIGEPY
YCEAQNSTSLGFGFSKRAESSTTSYQPEQNGTVTAEGVAIAQAIYKGLHNSAGERAYLSW
QIGSELSDAETKYSEDSGSWELNIPSTGGEYVAKFIQLLNIDNLSSLDDITYDTLVDWMS
TGYYRYLDSLQTIIPDLTSFYSNGGKLLHYHGESDPSIPAASSIHYWQSVRSIMYHEMSF
NESLTALDNWYQFYLVPGAAHCGANSLQPGPYPKSNMETIIEWVEKDKKPSGLNSTVSSG
DYEGEFQLLCKWPLRPFWKSNSSYDCVYDQASYDSWTYTFDAFKVPIY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaattgttcattattgccgctttatttgctacaattacaagggccagccct
atattaaaaagagatttatcttcaaataacagtagcactagttattcgcttgatgattta
tgctccatttcgcatgttcgggagtcgttgcctctgaatgggactttacttggtattgaa
atgattccgacatctgtcgaagttaatgtcgctgaaagttctaattactgctattgtaac
atctctgtttcttatgcgcatacaggaaaaaacgatactattgtcctcaactatgctttg
ccggatccttccaccttcgagagtagattttacgttgctggtggaggtggttatagcctt
agtagttcttctactggtggtctttcctatggtgctgtaggcggttgcactgatgctggt
tacgatgccttcagtacatcttatgatgaggtggttctttttggtaatggttctattaac
tgggacgcaacttacatgttcgcttaccaaggattgggtgaaatgaccaccataggtaaa
gctctcactagtgttttctacggaatgtctgacgatgaaaagctttatacttactttgaa
ggttgctccgatggtggccgtcaaggtatgagtcaaatacaaaggtatggagatttgtat
gatggtgctgctatcggtgcacctgctttcaggtatgctcaacaacaagtcaatcatgtt
tacccttccatggttgaagaagatttgaattactttccacctccatgtgaattgagtaaa
attatcaatgctacaattggtgcctgtgattctctcgacggtcgtatagatggagttatt
tccagaacagatctatgtatgcttaggtttaatttgagttctataattggagaaccctat
tattgtgaagctcaaaatagtacttctcttggatttggctttagcaaaagagccgaaagt
agtactacctcttatcaaccagagcaaaacggtacagttactgctgagggagtagctatt
gctcaagcaatttataaaggccttcacaattctgctggtgaaagagcctatctttcgtgg
caaattggttccgaacttagtgatgctgaaactaaatatagcgaagattcggggtcttgg
gagcttaatatcccatccactggaggggaatacgttgcaaaatttattcagttattaaat
attgataacctctcatctctcgatgacatcacttacgacacattagttgactggatgtcc
accggttactatagatacttggattctttacaaacaataatacctgacttaacctcattt
tactcgaatggaggaaaattgttacactatcacggtgaatctgatccaagtattcctgcc
gcttcttcgattcattactggcaaagtgttcgttctattatgtaccatgaaatgtctttt
aatgaatcgcttactgctcttgacaactggtatcagttttatttagtaccgggtgctgct
cactgtggtgcaaatagcttgcaaccaggcccatatccaaaatctaatatggagaccatt
atagaatgggtggaaaaagataagaaaccatccggtcttaattcaactgtctcttcaggt
gactatgaaggcgaatttcaacttctttgcaaatggccacttcgtccattttggaaaagt
aattccagttatgactgtgtttatgaccaggcatcttatgattcttggacatacactttt
gatgccttcaaagttccaatttactga

DBGET integrated database retrieval system