KEGG   Debaryomyces hansenii: DEHA2B01672gHelp
Entry
DEHA2B01672g      CDS       T01026                                 

Definition
DEHA2B01672p
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dha  Debaryomyces hansenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DEHA2B01672g
Enzymes [BR:dha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DEHA2B01672g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DEHA2B01672g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(131761..133896)
Genome map
AA seq 711 aa AA seqDB search
MSLSTGSTGSERSNQSLIKGALDLDPWLEPFSGQLIHRQLNLRKWYDEFKQNEGSLTNFA
SAYEKYGLHANWDTKEVFINEYIPNVVEVSLVGDFNNWDTNTHKLKPVNDFGLWSLTIKP
TENNEFAVPHDSRYKISMVTASGERIYRLCPWLKRATPSTENNLYEGRFWNPQPTETYKF
KHERPRLESKDGIKIYEAHVGISTPEPKVGSYKNFTTKVLPVIHKLGYNTIQLMAVMEHA
YYASFGYQVTNFFAISSRFGTPEDLKELIDEAHRLGIRVLLDVVHSHSSKNVEDGLNMFN
GTDHYLFHGGTKGSHELWDSRLFNYSNYETLRFLLSNLRFYIDVFKFDGFRFDGVTSMLY
KHHGLSFGFSGDYNEYFNSEWVDNDAITYLMLGHKLLDEISVRENNYKFVSIAEDVSGMP
TLCLPIGQGGIGFDYRLSMAIPDMWIKIIKHLSDEEWDMGSLVHTLTNRRHGERCISYCE
SHDQALVGDKTIAFWLMDKEMYTNMSTLTPFTPVIDRGIALHKMIRLITFSLGGEGYLNF
EGNEFGHPEWLDFPRKGNGESYAYARRQFNLIEDDLLRYKFLFAFDGAMQHLDTKYGILL
SSQAYVSLKNENDKVIVFERNGLLFIFNFHPTNSYADYKIGVETPGVYQIVLNSDSLSFG
GHGRIEETNKETGEKLQFFTNNERWNDRSNALFCYIPSRTAIVLQVKEKVV
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttatctacaggttccacaggttcagagagaagtaatcaatccttgattaagggc
gcattagatttagacccttggttagaacccttctctggacaattgatacaccgtcaatta
aacttgagaaaatggtacgatgaattcaaacagaatgaaggtagtttaactaactttgca
tctgcgtatgaaaagtatggtttgcatgctaattgggatactaaggaagtgttcattaac
gaatatattccaaatgtggtagaggtttcgttggtaggggattttaataattgggacact
aacacccataaattgaaaccagtaaatgattttggactttggtcattgacaatcaagcca
acagagaacaatgaatttgctgtcccgcatgactccagatataagatttcgatggtcacc
gcaagtggagagcgaatctacagattatgtccatggttgaaaagggctacaccttctact
gaaaacaacttgtatgagggaaggttttggaatccacagccgactgaaacatataaattc
aagcatgagagaccaagacttgaaagcaaggatggtataaaaatttacgaagctcatgtg
ggtatttctaccccggaaccaaaagttgggtcatataagaacttcacaactaaggtgttg
cctgttatccataagttaggatataacactattcaattaatggcggttatggagcatgct
tattatgcgtcgttcggttatcaggtcactaatttttttgcaatttcttctcgttttggc
acgccagaagatttgaaagaattaattgacgaagcccatagattgggtattagagttttg
ctagatgtggttcattcccatagttctaaaaatgttgaagatggtttgaatatgtttaat
ggtacggatcactatttattccatggtggcactaagggttcgcatgaattatgggattct
agattattcaattactctaactacgaaaccttgagattcttgttgtcaaacttgaggttt
tatattgatgtctttaaatttgatggattcagatttgatggcgtcacaagtatgttatac
aaacatcatggcttgagttttggatttagtggtgattacaatgaatatttcaattctgag
tgggtcgataatgacgcaataacatatttaatgttgggccataaattattagatgagatc
agtgtaagagaaaacaactacaaatttgtctccattgctgaagatgttagtggtatgcca
acattgtgcttaccgatcggtcagggtggtattggatttgactacaggttatctatggct
attccagatatgtggattaagattattaaacatttgagtgatgaagaatgggatatggga
agccttgtgcataccttaactaatagaagacatggtgaaaggtgtattagttattgtgaa
tcccatgatcaagcattagtgggtgataagaccattgctttttggttaatggataaagaa
atgtacaccaatatgtcaacattgactcctttcacgccagttatcgatagaggtattgcg
ttgcataaaatgattaggttaattactttctctttagggggagaaggttatttaaatttc
gaaggcaatgagtttggccaccctgaatggttagactttccaagaaaaggaaacggcgaa
tcatatgcttatgccagaagacaattcaatttaattgaagatgatttattgcgttacaag
tttttgtttgcttttgatggtgcaatgcaacatttagataccaagtatggtatattgttg
tcttcgcaagcctatgtatctttgaaaaatgaaaatgataaggttattgtctttgaaaga
aacggcttattattcatttttaattttcatcctaccaattcttatgctgattacaagatt
ggggtagaaaccccaggtgtctaccaaatagttttaaactcggacagtcttagtttcgga
ggtcatggtagaattgaagaaacaaacaaagaaacgggtgaaaaattacaattcttcact
aacaatgaaagatggaatgatagatctaatgcattattttgttatattccatcaagaacg
gcaattgtccttcaagtcaaggaaaaagtcgtttag

DBGET integrated database retrieval system