KEGG   Debaryomyces hansenii: DEHA2B03388gHelp
Entry
DEHA2B03388g      CDS       T01026                                 

Definition
DEHA2B03388p
Orthology
K06634  
cyclin H
Organism
dha  Debaryomyces hansenii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dha00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    DEHA2B03388g
  Replication and repair
   03420 Nucleotide excision repair
    DEHA2B03388g
Transcription machinery [BR:dha03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     DEHA2B03388g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:278903..280180
Genome map
AA seq 425 aa AA seqDB search
MADKGSAEPSKNIEEDGTSYPIRKKPQVTVDDLYRRSTQYQLWSFTSESLQEAKQKINEK
GRQHAIEEFNKALLKLKSGSKENVDKYQAELTSEKLLDLLTLEEELKYLNFYCENIIKVV
NSFRMPTQVKATAVSFFKKFYLVNSVMEYHPKNILYTCVFLAAKSENYFMSIESFCKALP
KTEPKDVLDLEFIVLQSLKFTLLVHHPFRPLYGFFLDFQAVLLHPSPLMYDVNIDTIGGM
YDKAKKWLSDYALLSDVAFLFSPPQIALAAMYDIDKRITDRYLKKKFLSEHHYDEENTQV
KLDTIKEDPESKADNSAVDNTVKDNDKETDMTPMEIHQDKENLEAKTEDNSKSDIHKMQR
EQYETLVRTIRKCIKIAKQIPQTSREESAKVDKKCFFALNPSRLLKKKLSKLTTGNDATP
VPASS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaggatcggcagaaccaagtaagaatatagaggaagatggaacatcatac
ccaatacgaaagaagcctcaggtaacggtcgatgatttatatagacgatcgacacagtat
cagctttggtctttcacttcagaatcattacaagaagctaaacagaagataaatgaaaag
ggcagacagcacgcaatcgaggaatttaataaggctctcttgaaactcaagtcaggatct
aaggagaatgttgataaatatcaagccgaattaacttcggagaaattactagatctactt
acactagaagaagaattaaaatacctaaacttttactgtgaaaatattatcaaagtggtt
aattcattcagaatgccaacacaagtgaaagcaacggcagtatcgtttttcaagaaattt
tatttggttaactcagtaatggaatatcatcctaagaacatattatacacctgtgttttc
ctagcagctaagtctgaaaattacttcatgtccatagaatcattttgtaaggcactcccg
aagacagaaccaaaggatgttctcgatttagaatttatagtcctacaatctttgaaattc
acgttgttagtccaccatccattcagaccattatatgggtttttccttgatttccaagca
gtattattacatccttcccccttaatgtacgatgtcaatatcgatacaattggtggaatg
tatgataaagccaaaaagtggttaagtgattatgcattgttaagcgacgttgcatttctt
ttctcaccaccacaaattgccctcgctgctatgtatgatattgataagagaataacggat
agatatttaaaaaaaaaattcttatcggaacaccattatgacgaagaaaatactcaggta
aaactcgatacgattaaagaagatccagaactgaaggctgataattcggcagtggataac
accgttaaagataatgacaaagagacagatatgacaccgatggaaatacatcaggacaaa
gaaaatctagaggctaaaacagaagataattctaagagtgatatacataaaatgcaaaga
gaacaatatgaaactttggttagaacgataaggaaatgcattaaaatagctaaacaaata
ccacaaacttctcgggaggaaagtgcgaaagtcgacaagaagtgtttcttcgcattaaac
cctagtagattgttgaagaagaagctcagtaaattgactacgggcaatgatgctacccca
gttccagcttcaagctga

DBGET integrated database retrieval system