KEGG   Debaryomyces hansenii: DEHA2B05764gHelp
Entry
DEHA2B05764g      CDS       T01026                                 

Definition
(RefSeq) DEHA2B05764p
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
dha  Debaryomyces hansenii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DEHA2B05764g
   00640 Propanoate metabolism
    DEHA2B05764g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    DEHA2B05764g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    DEHA2B05764g
Enzymes [BR:dha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     DEHA2B05764g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     DEHA2B05764g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
B:465900..472793
Genome map
AA seq 2297 aa AA seqDB search
MSAICAKLKKLTTNISLNRLLFPNLNLRHQYRILKYIPVKRLNRYINYNSVNTTNNDTND
NKLKNTIDNKYRMSDVTTEVRNYTQMHQKLADHFKGLNSADNAEPGKVTDFVRSHEGHTV
ISRVLIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLEANAEYIRMADQFIE
VPGGTNNNNYANVELIVEIAERTNVDAVWAGWGHASENPLLPEMLAASPKKILFIGPPGS
AMRSLGDKISSTIVAQHADVPCIPWSGTGVREVKIDEETNLVSVSDAVYAKGCCTSPEDG
LVKAKEIGFPVMIKASEGGGGKGIRKVDNEKDFIALYKQASNEIPGSPIFIMKLAGDARH
LEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKKESFHAMENAAVRLGKLVGY
VSAGTVEYLYSHSEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRIRDI
RSLYGVDPHTSTEIDFEFKTESSLVSQRRPVPKGHTTACRITSEDPGEGFKPSGGSLHEL
NFRSSSNVWGYFSVGNQSSIHSFSDSQFGHIFAFGENRSASRKHMVVALKELSIRGDFRT
TVEYLIKLLETPDFEDNTITTGWLDELISKKLTSERPDHIVAVVCGAATKAHIQSEEDRK
EYIQSLEKGQVPNKALLRTIYPIEFIYEGYRYKFTATKSSNDSYTLFLNGTRGVVGVRSL
SDGGLLCAIDGKSHSIYWKEEPAATRLSVNGKTCLLEAENDPTQLRTPSPGKLVKYLIES
GEHVNSGEVYAEVEVMKMCMPLIAQDNGVVQLIKQPGSTVNAGDILAILELDDPSKVKHA
MPYEGTLPPLGDPVVRGTKSAHAFQHYTNILRNILAGFDNQVIMNSTLKSLIEILKNKDL
PYSEWNQYASALHSRLPIKLDEALSALIERNQSRGAEFPARQILKQIQKFTTDPSIDASV
NEVVKPLIDIATRYSNGLVEHEYEFFSNLINEYFEIENLFSGTNVREDDVVLKLRDENKA
DLNKVISIVLSHSRVSSKNNLVLAILDEYQPLLQSSSNTANGIRNALKDIVELDTRGAAK
VALKAREMLIQCSLPSIQERSDQLEHILRSSVLQTSYGEIYANHRTPRLDIIREVVDSKH
TVFDVLPQFLVNQDEWVSIAAAEVYVRRSYRAYSLGPITYDFHDKLPIIEWKFQLPSLNS
SQLTGVQQTQNPDQPAMNRAASVSDLSFVVDQNKEQKTRIGVLVPCRHLDDVDEMITAAL
EKIQPSDGITFKAKESEESKASYLNVFNIVVTNIDGYNNEEEVLARVHEILDEFKEDLKS
ASIRRITFVFANKIGVYPKYFTFTAPDYVENKVIRHIEPALAFQLELGRLNNFDIKPIFT
DNRNIHVYEAVGKNSPSDKRFFTRGIIRTGIIRNDISISEYLIAESNRLMSSILDALEVI
DTSNSDLNHIFINFSAVFNVLPEEVEAAFGSFLERFGRRLWRLRVTGAEIRIACTDPNTG
NSFPLRAIITNVSGYVVKSELYMEVKNTKGEWVFKSIGSTGSMHLRPISTPYPAKESLQP
KRYKAHNMGTTYVYDFPELFRQATLSQWKNHPKEKVPKEIFTSLELISDENGDLTAVERD
PGSNKIGMVGFKVTAKTPEYPRGRQFIIVANDITHKIGSFGPEEDEFFNKCTQLARKLGI
PRIYLSANSGARIGIADELVPLFNVAWNVEGSPDKGFRYLFLTPEDKKSIDEAGKSDTIV
TERIVEEGQERYVIKSIVGEEDGLGVECLKGSGLIAGSTSRAYKDIFTITLVTCRSVGIG
AYLVRLGQRAIQVEGQPIILTGAPAINKLLGRDVYSSNLQLGGTQIMYRNGVSHLTASDD
LAGVEKIMEWMSYVPAKRDMPIPILESEDSWDREVEYVPPKDEPYDVRWMIEGKQLDNGE
FESGLFDKNSFQETLSGWAKGVVVGRARLGGIPIGVIGVETRTIDNLVPADPANPESTEM
MIQEAGQVWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQRDMFNEVLKYGSFIV
DALVDFKQPIFTYIPPNGELRGGSWVVVDPTINADMMEMYADVNSRAGVLEPEGMVGIKY
RRDKLLSTIERLDPTYRDLKKQLNESKLSPEEHAQISAKLTTREKALLPIYAQVSVQFAD
LHDRSGRMLAKGVIRKEINWPEARRTFFWRLRRRLNEEYLLKLIGEQIKSDNKLEKVARL
KSWMPTVDYDDDMAVSNWIEQNHSKLQKRIEELKHESARQNLVNILREDPKSSVSVIKDF
LSNLPEDQRSEFAASLK
NT seq 6894 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatttgtgccaaattgaaaaaacttacaactaacatttcactcaataggtta
ctatttccaaatcttaatttacgtcatcaatatagaatattaaagtatattccagttaaa
cgacttaatagatacatcaactacaacagtgtcaacactactaataacgacaccaacgat
aacaaactaaagaataccattgataataaatataggatgtctgacgtaacaacagaggtg
agaaattacactcaaatgcatcagaaattagctgaccactttaaagggttgaactcggca
gataatgctgagccaggtaaggtgacggactttgtaagatcgcacgaaggtcacacggta
atttcgagagttttaattgcaaataacggtattgctgccgtcaaggagatcagatcggtt
agaaaatgggcctacgagacattcggtgatgaaagggccattcaattcactgtgatggct
accccagaagatttggaagctaatgcggagtacattcgtatggcggaccaatttatcgag
gttccaggtggaactaacaataataattatgccaacgttgagttgatcgtggaaattgcc
gaaagaaccaatgttgacgctgtctgggccggatggggtcatgcttcagaaaacccatta
ttaccagaaatgttagctgcctctccaaagaaaatcttgtttatagggcctccgggatct
gctatgagatctttaggagataagatttcttctactatcgtagctcaacacgcagatgtt
ccatgtattccatggtccggtactggcgttagggaagttaagattgacgaagaaactaac
ttggtttcggtttccgacgctgtttacgccaagggttgttgcacaagtccagaagatggt
cttgttaaggcaaaagaaattggtttcccagtcatgatcaaagcttctgaaggtggtggt
ggtaaaggtattagaaaagtcgataacgaaaaagactttattgccttatacaagcaagct
tcgaacgaaattccaggatctcctattttcattatgaagttagccggtgatgctagacat
ttggaagttcaattattagccgatcaatacggtacgaatatttctctttttggaagagat
tgttccgttcaaagaagacatcaaaagatcattgaagaggctccagtcactattgccaaa
aaagaaagtttccacgccatggaaaacgctgccgtaaggttaggtaaattagttggctat
gtttctgcaggtacagttgaatacctttattcgcatagtgaagataaattctatttctta
gaattgaatccaagattacaagttgaacatccgactactgaaatggtcactggggttaat
ttaccagctgcccaattacaaattgctatgggtattccaatgcaccgtattagggatatt
aggtcattatacggtgtagaccctcacacttctaccgaaattgattttgaatttaagact
gaaagttcattagttagtcagcgtcgtcctgttccaaagggccacactactgcatgtcgt
attacttcagaagatccaggtgaaggatttaagccttctgggggttcgttacatgaattg
aattttagatcatcttctaatgtctggggttatttctctgtcggtaatcaatcttctatt
cattctttctccgattcgcaattcggtcatatttttgcctttggtgaaaaccgttctgct
tcaagaaaacatatggttgttgctttgaaagaattatctattagaggtgattttagaact
accgtggaatatttaattaaattattagaaacaccagattttgaagacaatacaatcact
actggatggttagacgaattaatttcaaagaaattaacgtccgaaagacctgatcatatt
gttgcagttgtgtgtggtgccgctaccaaagcccatattcaatccgaagaagatagaaaa
gagtatatccaatcattggagaaaggtcaagttccaaacaaagctttattaaggactatt
tatccaattgaattcatttatgaaggatatagatataaattcaccgcaaccaagtcatct
aatgattcttatactttattcttaaatggtacaagaggagttgttggtgttcgttcatta
tctgatggtgggttattatgtgcaattgacgggaaatctcattctatttattggaaagaa
gagcctgctgcaaccagattatcagtgaatggtaaaacctgcttattagaagctgaaaac
gatccaacacaactaagaacaccatctccaggtaagttagtgaagtacttaattgaaagt
ggtgaacatgttaattccggagaagtttatgctgaggttgaagttatgaaaatgtgtatg
ccattaattgcccaagacaatggtgttgttcaattaataaaacagcctggctctacagtg
aatgctggtgatattttagctattttagagttagatgacccatctaaggttaaacatgct
atgccttacgaaggaaccttacctccattaggtgatcctgtcgttagaggtaccaaatca
gcacatgctttccaacattatactaatattttgagaaatatcttagcagggtttgataat
caagttatcatgaattcaactttgaagagcttaattgagatcttaaaaaacaaagacttg
ccctactcagaatggaatcagtatgcctctgcattacactcaagattaccaattaagtta
gatgaagcattgtcagctttgattgaaagaaaccaatcgagaggtgctgagttcccagct
cgtcaaatcttgaagcagattcaaaaattcactaccgatccatcgatcgatgcaagtgtt
aatgaagtggttaaaccattaattgatattgcgactagatactctaacggtcttgttgag
cacgagtatgaatttttctcaaatttgatcaatgaatactttgaaattgaaaacttattc
tctggtacaaatgttcgtgaggatgatgttgttttgaaattaagggatgaaaacaaagct
gatttaaataaagttattagtattgtattatctcattccagagtcagctcaaaaaacaat
ttagttttggctattttagatgaataccaaccactattacagtcatcttccaatacagct
aacggaattagaaatgcattgaaggatattgttgaattggatactagaggcgcggctaag
gtggctttgaaagcaagggaaatgttaattcaatgctctttgccatcaattcaagaaaga
tcagatcaattagaacatatcttgagatcctccgtgcttcaaacttcttatggtgagatc
tatgctaatcaccgtactccaagattagatattattcgcgaggttgtcgattccaaacac
acagtctttgacgtgttgcctcaatttttagtcaaccaagatgaatgggtttctattgcg
gctgcagaagtctatgttcgtcgttcatatagggcatactccttgggaccgatcacttat
gacttccatgacaaattaccgatcattgaatggaaattccaattaccaagtcttaactca
tcccagttaactggtgttcaacaaactcagaatccagatcaacctgctatgaaccgtgcg
gcatctgtttctgatttgtcttttgtcgtcgatcaaaacaaagaacaaaagacaagaatt
ggtgtcttagtaccttgtagacatcttgatgatgtggatgaaatgattactgcagcatta
gaaaagatccaaccttctgacggtattacgtttaaggctaaagagtcggaggaatctaaa
gcttcttatttaaatgttttcaacatcgtcgtaacgaatattgatggttacaataatgaa
gaggaagtattggcccgggttcatgaaattctcgatgaatttaaggaagaccttaagtca
gcttctattcgtcgtatcactttcgtatttgctaataagattggtgtttatcctaaatac
tttacttttaccgcaccagattatgttgaaaacaaggttatccgtcatattgagcctgca
ttggcattccaattggaattgggaagattaaataactttgacattaagccgatatttacc
gacaacagaaatattcatgtttatgaagctgttggtaagaactctccatctgataagaga
ttctttacaagaggtatcattaggactggaattattcgtaatgatataagtattagtgaa
tacttgattgccgaatctaatcgtttgatgtcaagcattttggatgcacttgaggttatt
gatacttctaattcagatcttaatcatatcttcatcaacttttctgctgtatttaatgtc
ttgcctgaggaggttgaagccgcttttggctcatttttagagagattcggtagaagattg
tggagattacgtgtgactggggctgaaattagaattgcatgtactgatccaaatactggt
aattctttcccattgcgcgcaattatcaccaatgtctcaggttacgttgttaaatctgag
ttgtatatggaagttaaaaacactaagggtgaatgggttttcaaatccattggttctacg
ggttccatgcacttgagaccaatttcaactccttatccagcgaaggaatcgttgcaacca
aaacgttataaggctcataatatgggtactacgtacgtttatgatttcccagaattattc
cgccaggctactctttctcaatggaaaaatcatccgaaagaaaaagttcctaaggaaatc
tttacgtctttagaattaatttctgacgagaatggagatttgacggcagtagaacgtgat
cctggcagcaacaagattggtatggttggattcaaggtaactgccaaaaccccagaatat
cctcgcggccgtcaatttattattgttgccaatgatattacccataaaattggttcattt
ggtccagaagaagatgaattcttcaacaaatgtactcaattagctagaaaattaggaatt
ccaagaatttatctttcagctaattccggtgccagaattggtattgctgatgaattggtt
ccacttttcaatgttgcttggaatgttgaaggttctccagataagggtttcagatactta
ttcttgacccctgaagataagaagagcattgatgaagctggaaaatctgatacaattgtc
actgaaagaatcgttgaagaaggccaggaaagatatgtcatcaagtcgatcgttggagaa
gaagatggtttaggtgttgaatgtcttaaaggatctggtttgattgctggtagtacctcg
agggcctataaggatattttcactattaccttagtgacttgtagatcagttggtattggt
gcttacttggttagattaggtcaaagagccattcaagttgaaggtcaaccaatcatttta
actggtgctcccgctattaataagttattaggtagagatgtctattcgtctaacttgcaa
ttaggtggtactcaaattatgtatcgtaatggtgtttcccatcttacagcttcagatgat
ttagcgggagttgagaagattatggaatggatgtcttatgttccggctaagcgtgatatg
ccaattccaattttggaaagtgaagacagctgggatagagaggttgaatatgttccacct
aaggatgaaccatatgatgttcgttggatgatagaaggaaaacagttagataatggtgaa
ttcgaatcaggtttatttgataagaattctttccaagaaacattatccggttgggccaaa
ggtgttgttgttggtagagcacgtcttggtggtataccaattggtgtcattggtgtcgaa
acaagaactatagacaacttagtacctgctgatcctgctaatccagagtccactgaaatg
atgattcaagaagctggtcaagtttggtatccaaactctgctttcaagactgctcaagcg
attaacgatttcaaccatggtgaacaattgccattaatgattttggctaactggagaggt
ttctctggtggtcaacgtgatatgttcaatgaagttcttaaatacggttcttttattgtt
gatgcgttagttgactttaagcaaccaattttcacttatattccaccaaatggtgaatta
agaggtggttcatgggttgttgttgacccaaccattaatgctgatatgatggaaatgtat
gctgatgtcaattccagagctggtgttttggaacccgagggaatggttggtattaaatac
agacgtgacaagttattatctactatagaaagattagatccaacatacagggaccttaaa
aagcaattaaacgaaagcaaattatcaccagaagaacatgcccaaatttctgctaagttg
actactcgtgaaaaggcattgttaccaatttatgcccaggtttcagttcaatttgctgac
ctccacgatagatctggtcgtatgttagccaagggtgtcattagaaaagaaatcaactgg
ccagaagcacgtcgtacctttttctggcgtttacgtcgtcgtttgaatgaagaatacttg
ttgaaacttattggtgaacaaatcaaatcagacaacaaattagaaaaggttgccaggttg
aagagttggatgccaacagttgactatgacgacgatatggctgtcagcaattggatcgaa
cagaaccactctaagttgcagaagagaattgaagaattgaaacacgaatccgctcgtcaa
aacttagttaatatcttgagagaggaccctaaaagctcggtttccgttattaaagatttc
ttatctaaccttccagaggaccaaagatcagaatttgcggcatccttaaaatag

DBGET integrated database retrieval system