KEGG   Debaryomyces hansenii: DEHA2B05764gHelp
Entry
DEHA2B05764g      CDS       T01026                                 

Definition
DEHA2B05764p
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dha  Debaryomyces hansenii
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    DEHA2B05764g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DEHA2B05764g
   00640 Propanoate metabolism
    DEHA2B05764g
  Lipid metabolism
   00061 Fatty acid biosynthesis
    DEHA2B05764g
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    DEHA2B05764g
Enzymes [BR:dha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     DEHA2B05764g
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     DEHA2B05764g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:465900..472793
Genome map
AA seq 2297 aa AA seqDB search
MSAICAKLKKLTTNISLNRLLFPNLNLRHQYRILKYIPVKRLNRYINYNSVNTTNNDTND
NKLKNTIDNKYRMSDVTTEVRNYTQMHQKLADHFKGLNSADNAEPGKVTDFVRSHEGHTV
ISRVLIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLEANAEYIRMADQFIE
VPGGTNNNNYANVELIVEIAERTNVDAVWAGWGHASENPLLPEMLAASPKKILFIGPPGS
AMRSLGDKISSTIVAQHADVPCIPWSGTGVREVKIDEETNLVSVSDAVYAKGCCTSPEDG
LVKAKEIGFPVMIKASEGGGGKGIRKVDNEKDFIALYKQASNEIPGSPIFIMKLAGDARH
LEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKKESFHAMENAAVRLGKLVGY
VSAGTVEYLYSHSEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRIRDI
RSLYGVDPHTSTEIDFEFKTESSLVSQRRPVPKGHTTACRITSEDPGEGFKPSGGSLHEL
NFRSSSNVWGYFSVGNQSSIHSFSDSQFGHIFAFGENRSASRKHMVVALKELSIRGDFRT
TVEYLIKLLETPDFEDNTITTGWLDELISKKLTSERPDHIVAVVCGAATKAHIQSEEDRK
EYIQSLEKGQVPNKALLRTIYPIEFIYEGYRYKFTATKSSNDSYTLFLNGTRGVVGVRSL
SDGGLLCAIDGKSHSIYWKEEPAATRLSVNGKTCLLEAENDPTQLRTPSPGKLVKYLIES
GEHVNSGEVYAEVEVMKMCMPLIAQDNGVVQLIKQPGSTVNAGDILAILELDDPSKVKHA
MPYEGTLPPLGDPVVRGTKSAHAFQHYTNILRNILAGFDNQVIMNSTLKSLIEILKNKDL
PYSEWNQYASALHSRLPIKLDEALSALIERNQSRGAEFPARQILKQIQKFTTDPSIDASV
NEVVKPLIDIATRYSNGLVEHEYEFFSNLINEYFEIENLFSGTNVREDDVVLKLRDENKA
DLNKVISIVLSHSRVSSKNNLVLAILDEYQPLLQSSSNTANGIRNALKDIVELDTRGAAK
VALKAREMLIQCSLPSIQERSDQLEHILRSSVLQTSYGEIYANHRTPRLDIIREVVDSKH
TVFDVLPQFLVNQDEWVSIAAAEVYVRRSYRAYSLGPITYDFHDKLPIIEWKFQLPSLNS
SQLTGVQQTQNPDQPAMNRAASVSDLSFVVDQNKEQKTRIGVLVPCRHLDDVDEMITAAL
EKIQPSDGITFKAKESEESKASYLNVFNIVVTNIDGYNNEEEVLARVHEILDEFKEDLKS
ASIRRITFVFANKIGVYPKYFTFTAPDYVENKVIRHIEPALAFQLELGRLNNFDIKPIFT
DNRNIHVYEAVGKNSPSDKRFFTRGIIRTGIIRNDISISEYLIAESNRLMSSILDALEVI
DTSNSDLNHIFINFSAVFNVLPEEVEAAFGSFLERFGRRLWRLRVTGAEIRIACTDPNTG
NSFPLRAIITNVSGYVVKSELYMEVKNTKGEWVFKSIGSTGSMHLRPISTPYPAKESLQP
KRYKAHNMGTTYVYDFPELFRQATLSQWKNHPKEKVPKEIFTSLELISDENGDLTAVERD
PGSNKIGMVGFKVTAKTPEYPRGRQFIIVANDITHKIGSFGPEEDEFFNKCTQLARKLGI
PRIYLSANSGARIGIADELVPLFNVAWNVEGSPDKGFRYLFLTPEDKKSIDEAGKSDTIV
TERIVEEGQERYVIKSIVGEEDGLGVECLKGSGLIAGSTSRAYKDIFTITLVTCRSVGIG
AYLVRLGQRAIQVEGQPIILTGAPAINKLLGRDVYSSNLQLGGTQIMYRNGVSHLTASDD
LAGVEKIMEWMSYVPAKRDMPIPILESEDSWDREVEYVPPKDEPYDVRWMIEGKQLDNGE
FESGLFDKNSFQETLSGWAKGVVVGRARLGGIPIGVIGVETRTIDNLVPADPANPESTEM
MIQEAGQVWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQRDMFNEVLKYGSFIV
DALVDFKQPIFTYIPPNGELRGGSWVVVDPTINADMMEMYADVNSRAGVLEPEGMVGIKY
RRDKLLSTIERLDPTYRDLKKQLNESKLSPEEHAQISAKLTTREKALLPIYAQVSVQFAD
LHDRSGRMLAKGVIRKEINWPEARRTFFWRLRRRLNEEYLLKLIGEQIKSDNKLEKVARL
KSWMPTVDYDDDMAVSNWIEQNHSKLQKRIEELKHESARQNLVNILREDPKSSVSVIKDF
LSNLPEDQRSEFAASLK
NT seq 6894 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatttgtgccaaattgaaaaaacttacaactaacatttcactcaataggtta
ctatttccaaatcttaatttacgtcatcaatatagaatattaaagtatattccagttaaa
cgacttaatagatacatcaactacaacagtgtcaacactactaataacgacaccaacgat
aacaaactaaagaataccattgataataaatataggatgtctgacgtaacaacagaggtg
agaaattacactcaaatgcatcagaaattagctgaccactttaaagggttgaactcggca
gataatgctgagccaggtaaggtgacggactttgtaagatcgcacgaaggtcacacggta
atttcgagagttttaattgcaaataacggtattgctgccgtcaaggagatcagatcggtt
agaaaatgggcctacgagacattcggtgatgaaagggccattcaattcactgtgatggct
accccagaagatttggaagctaatgcggagtacattcgtatggcggaccaatttatcgag
gttccaggtggaactaacaataataattatgccaacgttgagttgatcgtggaaattgcc
gaaagaaccaatgttgacgctgtctgggccggatggggtcatgcttcagaaaacccatta
ttaccagaaatgttagctgcctctccaaagaaaatcttgtttatagggcctccgggatct
gctatgagatctttaggagataagatttcttctactatcgtagctcaacacgcagatgtt
ccatgtattccatggtccggtactggcgttagggaagttaagattgacgaagaaactaac
ttggtttcggtttccgacgctgtttacgccaagggttgttgcacaagtccagaagatggt
cttgttaaggcaaaagaaattggtttcccagtcatgatcaaagcttctgaaggtggtggt
ggtaaaggtattagaaaagtcgataacgaaaaagactttattgccttatacaagcaagct
tcgaacgaaattccaggatctcctattttcattatgaagttagccggtgatgctagacat
ttggaagttcaattattagccgatcaatacggtacgaatatttctctttttggaagagat
tgttccgttcaaagaagacatcaaaagatcattgaagaggctccagtcactattgccaaa
aaagaaagtttccacgccatggaaaacgctgccgtaaggttaggtaaattagttggctat
gtttctgcaggtacagttgaatacctttattcgcatagtgaagataaattctatttctta
gaattgaatccaagattacaagttgaacatccgactactgaaatggtcactggggttaat
ttaccagctgcccaattacaaattgctatgggtattccaatgcaccgtattagggatatt
aggtcattatacggtgtagaccctcacacttctaccgaaattgattttgaatttaagact
gaaagttcattagttagtcagcgtcgtcctgttccaaagggccacactactgcatgtcgt
attacttcagaagatccaggtgaaggatttaagccttctgggggttcgttacatgaattg
aattttagatcatcttctaatgtctggggttatttctctgtcggtaatcaatcttctatt
cattctttctccgattcgcaattcggtcatatttttgcctttggtgaaaaccgttctgct
tcaagaaaacatatggttgttgctttgaaagaattatctattagaggtgattttagaact
accgtggaatatttaattaaattattagaaacaccagattttgaagacaatacaatcact
actggatggttagacgaattaatttcaaagaaattaacgtccgaaagacctgatcatatt
gttgcagttgtgtgtggtgccgctaccaaagcccatattcaatccgaagaagatagaaaa
gagtatatccaatcattggagaaaggtcaagttccaaacaaagctttattaaggactatt
tatccaattgaattcatttatgaaggatatagatataaattcaccgcaaccaagtcatct
aatgattcttatactttattcttaaatggtacaagaggagttgttggtgttcgttcatta
tctgatggtgggttattatgtgcaattgacgggaaatctcattctatttattggaaagaa
gagcctgctgcaaccagattatcagtgaatggtaaaacctgcttattagaagctgaaaac
gatccaacacaactaagaacaccatctccaggtaagttagtgaagtacttaattgaaagt
ggtgaacatgttaattccggagaagtttatgctgaggttgaagttatgaaaatgtgtatg
ccattaattgcccaagacaatggtgttgttcaattaataaaacagcctggctctacagtg
aatgctggtgatattttagctattttagagttagatgacccatctaaggttaaacatgct
atgccttacgaaggaaccttacctccattaggtgatcctgtcgttagaggtaccaaatca
gcacatgctttccaacattatactaatattttgagaaatatcttagcagggtttgataat
caagttatcatgaattcaactttgaagagcttaattgagatcttaaaaaacaaagacttg
ccctactcagaatggaatcagtatgcctctgcattacactcaagattaccaattaagtta
gatgaagcattgtcagctttgattgaaagaaaccaatcgagaggtgctgagttcccagct
cgtcaaatcttgaagcagattcaaaaattcactaccgatccatcgatcgatgcaagtgtt
aatgaagtggttaaaccattaattgatattgcgactagatactctaacggtcttgttgag
cacgagtatgaatttttctcaaatttgatcaatgaatactttgaaattgaaaacttattc
tctggtacaaatgttcgtgaggatgatgttgttttgaaattaagggatgaaaacaaagct
gatttaaataaagttattagtattgtattatctcattccagagtcagctcaaaaaacaat
ttagttttggctattttagatgaataccaaccactattacagtcatcttccaatacagct
aacggaattagaaatgcattgaaggatattgttgaattggatactagaggcgcggctaag
gtggctttgaaagcaagggaaatgttaattcaatgctctttgccatcaattcaagaaaga
tcagatcaattagaacatatcttgagatcctccgtgcttcaaacttcttatggtgagatc
tatgctaatcaccgtactccaagattagatattattcgcgaggttgtcgattccaaacac
acagtctttgacgtgttgcctcaatttttagtcaaccaagatgaatgggtttctattgcg
gctgcagaagtctatgttcgtcgttcatatagggcatactccttgggaccgatcacttat
gacttccatgacaaattaccgatcattgaatggaaattccaattaccaagtcttaactca
tcccagttaactggtgttcaacaaactcagaatccagatcaacctgctatgaaccgtgcg
gcatctgtttctgatttgtcttttgtcgtcgatcaaaacaaagaacaaaagacaagaatt
ggtgtcttagtaccttgtagacatcttgatgatgtggatgaaatgattactgcagcatta
gaaaagatccaaccttctgacggtattacgtttaaggctaaagagtcggaggaatctaaa
gcttcttatttaaatgttttcaacatcgtcgtaacgaatattgatggttacaataatgaa
gaggaagtattggcccgggttcatgaaattctcgatgaatttaaggaagaccttaagtca
gcttctattcgtcgtatcactttcgtatttgctaataagattggtgtttatcctaaatac
tttacttttaccgcaccagattatgttgaaaacaaggttatccgtcatattgagcctgca
ttggcattccaattggaattgggaagattaaataactttgacattaagccgatatttacc
gacaacagaaatattcatgtttatgaagctgttggtaagaactctccatctgataagaga
ttctttacaagaggtatcattaggactggaattattcgtaatgatataagtattagtgaa
tacttgattgccgaatctaatcgtttgatgtcaagcattttggatgcacttgaggttatt
gatacttctaattcagatcttaatcatatcttcatcaacttttctgctgtatttaatgtc
ttgcctgaggaggttgaagccgcttttggctcatttttagagagattcggtagaagattg
tggagattacgtgtgactggggctgaaattagaattgcatgtactgatccaaatactggt
aattctttcccattgcgcgcaattatcaccaatgtctcaggttacgttgttaaatctgag
ttgtatatggaagttaaaaacactaagggtgaatgggttttcaaatccattggttctacg
ggttccatgcacttgagaccaatttcaactccttatccagcgaaggaatcgttgcaacca
aaacgttataaggctcataatatgggtactacgtacgtttatgatttcccagaattattc
cgccaggctactctttctcaatggaaaaatcatccgaaagaaaaagttcctaaggaaatc
tttacgtctttagaattaatttctgacgagaatggagatttgacggcagtagaacgtgat
cctggcagcaacaagattggtatggttggattcaaggtaactgccaaaaccccagaatat
cctcgcggccgtcaatttattattgttgccaatgatattacccataaaattggttcattt
ggtccagaagaagatgaattcttcaacaaatgtactcaattagctagaaaattaggaatt
ccaagaatttatctttcagctaattccggtgccagaattggtattgctgatgaattggtt
ccacttttcaatgttgcttggaatgttgaaggttctccagataagggtttcagatactta
ttcttgacccctgaagataagaagagcattgatgaagctggaaaatctgatacaattgtc
actgaaagaatcgttgaagaaggccaggaaagatatgtcatcaagtcgatcgttggagaa
gaagatggtttaggtgttgaatgtcttaaaggatctggtttgattgctggtagtacctcg
agggcctataaggatattttcactattaccttagtgacttgtagatcagttggtattggt
gcttacttggttagattaggtcaaagagccattcaagttgaaggtcaaccaatcatttta
actggtgctcccgctattaataagttattaggtagagatgtctattcgtctaacttgcaa
ttaggtggtactcaaattatgtatcgtaatggtgtttcccatcttacagcttcagatgat
ttagcgggagttgagaagattatggaatggatgtcttatgttccggctaagcgtgatatg
ccaattccaattttggaaagtgaagacagctgggatagagaggttgaatatgttccacct
aaggatgaaccatatgatgttcgttggatgatagaaggaaaacagttagataatggtgaa
ttcgaatcaggtttatttgataagaattctttccaagaaacattatccggttgggccaaa
ggtgttgttgttggtagagcacgtcttggtggtataccaattggtgtcattggtgtcgaa
acaagaactatagacaacttagtacctgctgatcctgctaatccagagtccactgaaatg
atgattcaagaagctggtcaagtttggtatccaaactctgctttcaagactgctcaagcg
attaacgatttcaaccatggtgaacaattgccattaatgattttggctaactggagaggt
ttctctggtggtcaacgtgatatgttcaatgaagttcttaaatacggttcttttattgtt
gatgcgttagttgactttaagcaaccaattttcacttatattccaccaaatggtgaatta
agaggtggttcatgggttgttgttgacccaaccattaatgctgatatgatggaaatgtat
gctgatgtcaattccagagctggtgttttggaacccgagggaatggttggtattaaatac
agacgtgacaagttattatctactatagaaagattagatccaacatacagggaccttaaa
aagcaattaaacgaaagcaaattatcaccagaagaacatgcccaaatttctgctaagttg
actactcgtgaaaaggcattgttaccaatttatgcccaggtttcagttcaatttgctgac
ctccacgatagatctggtcgtatgttagccaagggtgtcattagaaaagaaatcaactgg
ccagaagcacgtcgtacctttttctggcgtttacgtcgtcgtttgaatgaagaatacttg
ttgaaacttattggtgaacaaatcaaatcagacaacaaattagaaaaggttgccaggttg
aagagttggatgccaacagttgactatgacgacgatatggctgtcagcaattggatcgaa
cagaaccactctaagttgcagaagagaattgaagaattgaaacacgaatccgctcgtcaa
aacttagttaatatcttgagagaggaccctaaaagctcggtttccgttattaaagatttc
ttatctaaccttccagaggaccaaagatcagaatttgcggcatccttaaaatag

DBGET integrated database retrieval system