KEGG   Debaryomyces hansenii: DEHA2B06336gHelp
Entry
DEHA2B06336g      CDS       T01026                                 

Definition
DEHA2B06336p
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dha  Debaryomyces hansenii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:dha00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    DEHA2B06336g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     DEHA2B06336g
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: Other group
  TTK family
   DEHA2B06336g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:513338..515845
Genome map
AA seq 835 aa AA seqDB search
MPLNDITPSSNIPKSSNGKKRFMDAQDDDNTFLPPALSSYSIALLNERTKQSPSHITGIY
EFDFPNSRSKNNLKNKLSVHFRESDPVHTIEKPDTPHSSHNNSSAPMEPTSNSNNNKSYN
TSHNASHNAITSTNPHIQNQNNISAHNSFNLSTNNFSSHTHNTTSEYNDDLMDISPHEST
SRNSSNHTPSTTFNENPPPSSSSQTKSSISQVHTLKRMRGTRRFGRMLGPPKRAMKLNED
KSTQAEYDGISSNENNDFQIPHNRAVSINNDDNNDNNNDDNINTNNNNNALSTPPPLFTM
DFSPKINRIDNLKEKNPESVFFKTLKKMKSESPEDDIISKQKESELRRRIDEQKRINEIE
SQLSKSKSIQDIEMEISELNNSRNEANDRSDKKGFVSSYLADTNEEGNKENLILSTSKDS
NISVKNEQPRLPLNNVSPNRLNRVAADETDFRKPKLPKPISQHATSNVTPPSSSDDYKRK
KCISINGNQYEKLELLGRGGSSKVYKVKSLSNNKLFAIKKVTFDQFDELCVQGFKGEIDL
LLKLKDADRVVKLVDHAIGEGSIYLVMECGDIDLAHVFQNKLSMNNVLDINFVKYHSIEI
LKCVQAVHRAGIVHSDLKPANFLFIRGILKIIDFGIANAVPDHTANIYRESQIGTPNYMA
PEALVEVSQAFPGLPTPDNNNNQQQLNGSQRNTWKVGKPSDVWSCGCIIYQMIYGRPPYG
GYSGNQRVMAIMNPQVKIQYPGKGIGNIKVPQSAIALMQKCLTRNPNERWTVEECLNSDF
LNPKIVSETFVRDLVHSAVNFGHNNRVNGNGLITADVYDRLVDTVLKQIEDLNFG
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgccccttaatgatataacgccatccagcaatataccgaagctgtctaatggtaagaag
cgttttatggacgcacaagacgatgataatacatttttaccaccagctttaagttcatat
agcatagcattattaaatgaaagaacgaaacagctgccctcgcatataaccgggatatat
gaatttgactttcccaatagtagatcgaagaataacttgaaaaacaaattatcagttcat
tttagagaatcagatccagttcatactatagaaaaaccagacacgccacattcaagtcac
aacaatagttcagcacctatggagcctactagcaactcgaacaataataaaagctataat
accagccataatgccagtcataatgccataacaagcactaatccacatatacagaatcaa
aataatatttcagctcacaactcattcaatttgtctacaaataatttcagttcacatact
cataatacaacttcagagtataatgacgatttaatggatatatcgccacatgaatccacg
tcaagaaattcatccaatcacacgccatccactacatttaatgaaaaccctcctccaagt
tcatcctcccaaacaaaatcgagtatttcacaagttcatactttaaagagaatgagagga
acaagacgattcggaaggatgttaggtccacccaaaagggccatgaaattgaatgaagat
aaaagtacacaagctgaatatgacggtatatctagtaatgaaaataatgacttccagatc
ccacacaatagggcggtttctattaacaatgatgacaataatgataataataatgatgat
aatatcaacactaataataataataatgcattatcaactcctccgcccttattcacgatg
gacttttcaccaaaaataaatcgcatagataacttgaaagagaaaaatccagaatcggtg
tttttcaaaacattgaaaaagatgaaatctgagtcgccagaagatgatatcatttcaaag
caaaaagaatctgaattgcgaagacgaattgatgaacagaaaaggataaacgaaatagag
agtcagttatccaaatccaaaagtattcaagatattgagatggagataagtgaattaaac
aattcaaggaatgaagcaaatgacagactggataaaaaagggtttgtttcttcatatttg
gcagacacaaacgaggaaggaaataaggaaaatttaattctctcaacctcaaaggattca
aatatatccgtaaagaacgaacagccaagattaccattaaataatgtgtcacctaaccgt
cttaacagagttgcagctgatgaaacagattttagaaaacctaaattgcctaaacctatt
tcacaacatgcaacctcaaatgtgacccctccaagtagttccgatgattacaaaaggaag
aaatgtattagcattaatggaaatcagtatgaaaaattggagctattgggtagaggtggg
tcgtcgaaagtttataaagtcaagtctttgtctaacaataaattgtttgccattaaaaag
gttacatttgatcaatttgatgaattatgtgtacagggatttaaaggagagattgattta
ttgttgaaattaaaggatgctgatagagtagttaaattagttgatcatgctattggtgaa
ggctctatttatctagtgatggaatgtggtgatattgacttggcacatgtctttcagaat
aagcttagcatgaataatgtcttggatattaattttgtcaagtatcattcaatcgaaatt
ttaaaatgtgttcaagcggtgcatagagcaggaatagttcatagcgaccttaagcctgcg
aatttcttatttattcgaggtattttgaaaattattgattttggaatagctaatgctgtg
ccggatcatacagcaaatatttaccgtgaatctcaaataggtacaccaaattatatggca
cccgaggcattggttgaagttagtcaggcttttccagggttaccaacgccagacaacaac
aataatcaacaacagttaaatggactgcaaagaaacacctggaaagttggaaagccatct
gatgtttggtcatgcggttgtattatatatcagatgatttatggaaggcctccatatggt
ggatactctggaaatcaaagagtaatggcaatcatgaatccgcaggtaaagatacagtat
ccaggtaaaggcataggtaatataaaggtgcctcaaagtgctatcgcattgatgcaaaag
tgcttaactaggaatcctaatgaaagatggactgttgaagaatgtttaaatagtgatttt
ttgaatcctaagattgtcagtgaaacttttgtcagagatttagttcatctggctgttaat
tttggccataataatcgtgttaatggcaacgggttgattacagcagacgtttatgaccgc
ttagtggataccgtattgaagcaaatagaagatttgaattttggttaa

DBGET integrated database retrieval system