KEGG   Debaryomyces hansenii: DEHA2B06754gHelp
Entry
DEHA2B06754g      CDS       T01026                                 

Definition
DEHA2B06754p
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dha  Debaryomyces hansenii
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DEHA2B06754g
   00330 Arginine and proline metabolism
    DEHA2B06754g
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    DEHA2B06754g
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    DEHA2B06754g
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    DEHA2B06754g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     DEHA2B06754g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:544418..545512
Genome map
AA seq 364 aa AA seqDB search
MRPKIVVIGAGVSGLTTALELKKSSSEYDVTVVAQHLPGDYDVNYVSPYAGANWYSFATP
EDKVLQAFDKPSYRAFMELAQNEPRSGIWHKMSYAYFTEDYMKEINYDTGKGIPWFKDFV
EEFKILEKKELPEGILFGFSFKGVVISVPIYLNFLLSKALENGIAIKRVKAIENVEDARN
LHSSGNKANLVINCSGLLAFNLKGYNDPNRSYGIRGQTLHVRNNASKQIEVQSFGPGFED
EMLYIMPRKEGGSIIGGCFIENYKNTEEDKELTQRLVNRAKKYAPEMFDPGFKNNPTEID
IIRVNVGLRPFRDGGVRVENDSDNDWLIHNYGAGGGGYQGSHGFSSTVVSLVKQALDKKM
ASKL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagaccaaagatcgtggtaattggtgctggtgtgagtggtcttaccacagcattagaa
ttgaagaaatctagttcggaatatgatgtgactgtcgtagcacaacatttaccaggagat
tatgatgttaactacgtttccccatatgctggggcgaattggtattcgtttgctacccca
gaagataaggttctacaagcattcgataagccatcctatagagcatttatggaattagct
cagaatgagcctagatcgggaatttggcataaaatgagttatgcatattttactgaggat
tacatgaaggagatcaattacgatactggaaaaggaatcccatggttcaaggattttgta
gaagaattcaagatccttgagaaaaaggagttaccagaaggcattttgtttgggtttctg
tttaagggagttgttatatcggttccaatatacttgaattttttgctttctaaggcactt
gaaaatggaatcgcaattaaaagggtaaaagctatcgagaatgtcgaggatgctagaaat
cttcactcttctggaaacaaggcgaatttggttattaattgttctgggttattggcgttt
aacttgaaggggtacaatgatcctaatcgttcgtatgggatacggggtcagacattgcac
gtaagaaataacgcatcgaaacagattgaagtacagtcattcggccctggctttgaagac
gaaatgctctacattatgccccgtaaagaaggtggatcaattattggaggctgttttatc
gagaactataagaatacagaagaagacaaagaattgacccaaagactagtcaacagagct
aagaagtatgctccagagatgttcgaccctggattcaagaataaccctaccgaaatagac
ataattcgtgtgaatgtaggattaagaccttttagagacggaggagttagggttgaaaat
gatagcgataacgactggttaattcacaattatggtgccggtggcggtggataccaaggt
agccatggattcagttctaccgtggtctcgcttgtcaaacaagctctagacaaaaaaatg
gctagcaaattgtaa

DBGET integrated database retrieval system