KEGG   Debaryomyces hansenii: DEHA2B08690gHelp
Entry
DEHA2B08690g      CDS       T01026                                 

Definition
DEHA2B08690p
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:696286..698856
Genome map
AA seq 856 aa AA seqDB search
MTIKKLSPDFEERFARISIDLSGCGANEGHSRLDPEITNPETARSFGVARSSRKKTYPSH
LYPNGTPSTNYTTPSKQPVLSTAKRAKSRNLSNQLKIASNSTTDDHLAVTPTRIESQNTH
KHGNRSMSTVKQPSKRILSCPMSERPNRTKDHSFSFMKETSSSMNKHVNVFNSGVGTSPT
PNRVSQEPQPSTKRVSSSNTTKRRHQLEHRTRNISGGSYNNGARERRIMSTQAPVTRPTD
ITNISYSVPTSKFHEIKSKDENLKIPNYNGLGYNPPYDSMNSPSKHRHVSQPFTQKSKDD
VYDRLYNNSNSNRTKTGTTSPRSLNSRSECHQTRNQCSENESNNTETPKIQNTHELLSII
YREDPDLFSFGYTSHKDFNKRQHMDTQNLNSGVSGYSGPLSIYERGEILRKKDIYFMPSE
NGNTLENDPRSINVRNYSQNFGFDDKTGNYIIVPHDHINYRYEIETILGNGSFGNVVRCK
DHKYFDSENNNKTVAIKIIKNDIKWSLQAVYETKMLKHLNEKMKTTEKTLFEKDFPILTY
IDHFHFRGHMCIISEMLSLNLYSLLEIIRFRGLSLNLLRSFSRSILTGLDFIHKQNIIHC
DIKPENIMIKLPSNFHPNNDAVNEKDLVVKIIDFGSSCFDKEISYSYIQSRFYRAPEVVL
GASYNNMIDIWSFGCVIAELFSGAPLLAGKNELEQIGLILELFGAPNSSLILEQRDKLMK
SAKRQKAATNFNNIDPNKGIDQSVMNKVSVDEKTIRKTLLFSLFDISGKINLQFLNMRSQ
VVANTISSTIPGASAVKKKFKPNSKGLEILLRLNTTRETKKDIQLFSKFLHSIFKWNPSE
RPPASELLNDSFLREL
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaagaagctatcaccggattttgaagagcggtttgcccgaataagcatcgat
ttatcgggttgtggagctaacgaaggccacagcagattagacccagagatcaccaacccc
gagacggcaagatcgtttggcgtggcaagatcgagcagaaagaagacatatccgtcccat
ctatacccgaatgggacgcctagtactaactataccacgccatctaaacagcccgtattg
tctacggccaagagggccaaatcgagaaacctttcgaatcagctcaaaattgcatccaac
tctacgacagatgatcatttagcggtcacgccaacgagaattgaatcccagaatacacat
aagcatggaaataggtccatgtctaccgtgaaacagccgtcgaagagaatattgagttgt
ccgatgtctgaaagaccgaaccgaacaaaagaccacctgttttctttcatgaaggaaacg
tcttcatcaatgaacaagcatgtgaatgttttcaacagcggtgttggaacgtcgcctacc
ccaaatcgggtatcccaagaaccccagccactgacaaagagagtcagctcatctaacacg
acaaagagaaggcatcagctagaacatcgtactcgtaatataagcggaggaagctacaat
aatggagcacgagaaagaagaatcatgtcaacgcaagcacctgttactagacccaccgat
atcaccaatataagctatagcgtgcccacgctgaagttccatgagattaagtcgaaagat
gagaatttaaagattcctaactacaatgggttgggctacaatcctccatatgactctatg
aactcgccgtcgaagcacagacatgtttcccagccatttactcaaaaatcaaaagatgat
gtatacgataggttgtataacaattcaaacagtaatagaaccaagacaggaaccacgtct
cccagaagcctaaattcaagactggagtgccaccaaactagaaaccaatgttcagagaat
gagtcgaataatacggagactccaaaaattcagaatacgcatgaactcttgctgataatt
taccgggaagatcctgatttattttcttttgggtatacaagtcataaagatttcaacaaa
cgacaacatatggatacccagaacttgaattctggtgtaagtggatattcgggaccattg
agcatatacgaaagaggtgaaatattgagaaagaaggatatatattttatgccgagcgaa
aatggcaataccttggaaaatgatcccaggtcaattaacgttagaaattacagccagaat
tttggatttgatgataagaccggaaattatataattgttcctcatgaccacatcaactat
cgttacgaaattgaaacaatattaggaaacggttcatttggtaatgtggtgagatgcaaa
gatcacaaatattttgattctgaaaataataacaaaacagttgcaataaaaataatcaag
aacgatataaaatggtcgttacaagctgtatacgaaaccaaaatgttaaagcatttaaac
gagaaaatgaaaaccaccgaaaaaacactattcgaaaaggatttccctatactaacatac
attgatcatttccattttagaggtcatatgtgtattatatctgaaatgttatcactaaat
ttatactctttactagaaatcataagatttcgtggcctatcgttaaatcttttaagactg
ttttctaggagtatattgacgggattggacttcatacataaacaaaatattattcattgt
gatataaaacctgaaaatatcatgataaagttgccatcaaatttccatccaaacaatgat
gcagtaaatgaaaaagatctcgtggtgaagattattgattttggctcctcttgttttgat
aaggaaatttcctactcttatatccaatcaagattctacagagcaccagaagttgtactt
ggcgctagttacaataatatgattgatatttggtcatttggttgtgtaatagcggaatta
ttttcaggagcaccattacttgcaggtaagaatgagttggagcagattggcttaatatta
gagttatttggtgctcccaatagcagccttattctagaacaaagagataagttaatgaaa
tcagcaaagagacaaaaagctgctactaatttcaataacattgacccgaataaaggtatt
gatcaatcggtcatgaataaagtctctgtggatgaaaagacaatccgaaaaacgcttctc
tttagtctttttgacatactggggaaaatcaatttacaattccttaacatgaggagccaa
gtggttgcaaatacaatctcttcaacaataccaggagcttctgctgtaaagaaaaaattc
aaaccaaattctaaaggtttggaaattttgttacgtctaaatacgaccagagaaactaaa
aaggacattcagttattctctaaatttttgcattcaatttttaaatggaacccttcggaa
agacctcctgcatcagaattattaaatgattcgtttttgagggaattataa

DBGET integrated database retrieval system