KEGG   Debaryomyces hansenii: DEHA2B08866gHelp
Entry
DEHA2B08866g      CDS       T01026                                 

Definition
DEHA2B08866p
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dha  Debaryomyces hansenii
Brite
Protein phosphatases and associated proteins [BR:dha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     DEHA2B08866g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(715451..715975)
Genome map
AA seq 174 aa AA seqDB search
MGVASSKILENLMEGTNFDKEEIERLRKRFMKLDKDGSGTIDKNEFLTIPGISSNPLAAR
LMDVFDEDGNGTIDFQEFIMGLSAFSGKTSKLDKLKFAFKIYDIDRDGYIGNGELFIVMK
MMVGKNLQDEELQQIVDKTMMEADEDGDGRLNFHEFKNAVDSKSVASALTLNMI
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagcgtcgtcaaagattttggaaaatctcatggaaggtactaacttcgataag
gaagaaatagagagattaagaaaaagatttatgaaattagacaaagatggctcaggaacc
atagacaaaaacgaattcttaaccatacccgggatatcgtcaaatcctttagctgcaaga
ttaatggacgtgttcgatgaagacggaaatggaacaatcgattttcaagaatttataatg
gggctatcagcatttagtggcaagacgtctaaactcgataaattgaagtttgcgttcaag
atttatgacatcgatagggatggatatattggaaatggagagctttttattgtaatgaag
atgatggtgggtaaaaatttacaagacgaagagttgcaacaaattgtcgataaaacgatg
atggaggccgatgaagatggtgatggaaggttgaactttcacgaattcaagaatgccgta
gattctaaatcggtggccagtgctttaactcttaacatgatttag

DBGET integrated database retrieval system