KEGG   Debaryomyces hansenii: DEHA2B09592gHelp
Entry
DEHA2B09592g      CDS       T01026                                 

Definition
DEHA2B09592p
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     DEHA2B09592g
    1.3.1.94  polyprenol reductase
     DEHA2B09592g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:754075..754974
Genome map
AA seq 299 aa AA seqDB search
MVKRPLEKLIGSFYVITLICIFLIKYIKTLNCLLKYGKNYENPQSKSTIINYLTSITVPK
RWFLHFYIVYFGCCFSTGCFLELVQRDSRLNSVITTFITSWSPASLESAPANYKHYKLIF
YLLCFQSFRRLLESMYITKFSSKAKINVFHYIMGLAFYTTISLNCFLSLLPYHLNTAIIP
VNDAFDLTDKILITLFIWLSIDQFQNHYHLSTLPKYSVPKFGMFQLVGSAHYLDEIILYL
IVAMIGNLHEKLSIIDINYILGWAFVAVNLSISSLESYSYYKAKFPEFTVKYSIIPGIL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaagaccattagaaaagcttataggcagcttctatgttataaccctaatatgc
atatttcttattaagtatattaagaccttaaactgtctacttaagtatggaaaaaattat
gaaaaccctcaatcaaaatcaaccataataaattatctaacttccatcaccgtccccaaa
cgatggttccttcatttttatatcgtatattttggatgctgttttagtaccggctgcttt
ctagagctagtccaaagggactcgaggcttaattcagtcataactacatttattacgtcg
tggctgcctgcttctttggaatcagcacctgctaactacaaacactacaagcttatattc
tatttattatgctttcagtcgttccgtagattgctcgaaagtatgtacatcacaaaattt
tcttcaaaagcgaagatcaacgtctttcattatattatggggttagccttctataccact
atctcattaaattgtttcctcagtttacttccataccatttgaataccgcgattattcct
gttaatgatgcctttgatctcactgataagattttaatcacgttatttatatggctatct
attgaccagttccagaaccattaccacctatcaaccctaccaaaatattccgtacccaag
tttggaatgtttcaattagttggatctgcccattatcttgacgagataatactatattta
atagttgcaatgatcggtaacctacacgaaaaattgtcgattattgatataaactacatc
ctaggttgggcatttgtcgcagttaacctatccattagctcattagagtcatattcatat
tacaaagctaaatttcctgagtttactgtgaagtatagtattattcctggcattttatga

DBGET integrated database retrieval system