KEGG   Debaryomyces hansenii: DEHA2B10890gHelp
Entry
DEHA2B10890g      CDS       T01026                                 

Definition
DEHA2B10890p
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dha  Debaryomyces hansenii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DEHA2B10890g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     DEHA2B10890g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(851232..852830)
Genome map
AA seq 532 aa AA seqDB search
MNLNKIPHNGRVAVIGGGISGLSFSYFLNKLRPDIKINIFESQNQPGGWIKSEYLQLKNE
KQKVLLEKGPRTLRGVSDGSLLIIDVLRNLNQSSKIEVMAHDSIANRKYLLSRENILVQV
PNSIKSFGKFLSSGIVNGILKGMLLEPFAKGRISPNEDESVESFITRRFGSSKLSDNILS
GVLHGIYAGDISKLSVRSVLPSLVSLETENGSIIKGMIKKIRETPPTKELSASLASYQDK
ISSNSNLLELASTLKKYPMVRLKDGLQTLPTSMAKYLESQPNVEIFYNSEIQEINAKTPH
IVVNNQVQKYDHIRSTINTNTLSKLITNDEIKAVLPLEYVSIFLVNIYCRKPILIPSDKN
GFGFLVPKVNQNHESLLGIMYDSDIERHVKPLYSNEKISTDNYNKITLMMGGHYYNKIGI
PSNNLNVKAIKNVLSSILNTSLKDHNLIFRNEAQMTDKSLSLEENDIMISYNLHRDCIPQ
YNVGYEKQKQKLYEIMNQQCNGKFSLGGMGFAAGMGVPDCVMNGLVDSLEIA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaacaagatacctcataatggtagggtggctgtaataggtggtggaatatct
ggattgtcgtttagttattttttgaataaattaaggcctgatataaagatcaatatattt
gaatctcaaaaccaacctgggggatggatcaaatcggagtacttgcaattgaaaaatgaa
aagcaaaaggttttgttggagaagggacctagaacattgagaggagttagcgatgggtca
ttattaattatagatgttctacggaacttgaatcaatcaagtaaaatagaagtaatggct
catgattcgattgcaaacagaaaatacctattatccagagaaaacatcttagttcaagtc
ccgaattcgatcaagtcttttggtaagtttctaagcagcggtattgttaatggtatcttg
aaaggaatgcttctagagccatttgccaagggtagaatatcaccaaatgaggacgagagt
gtcgaaagttttattactaggaggttcggaagtagtaagttatccgacaatattctcagc
ggtgttttgcatggtatttatgctggagatatttctaagcttagtgtccgctcggtttta
cctagtttagttagtcttgaaactgaaaatggatcaataattaaaggtatgattaagaaa
ataagagaaactcctccaacaaaagagctatccgcttcattagcaagttatcaggacaag
atatcaagcaatagtaatttattagaattagcctcaactttaaaaaagtatcctatggtt
agattgaaagatggcttacagacgcttccaacaagcatggcaaagtatttagaactgcag
ccgaacgtggaaattttttacaattctgaaattcaagaaattaatgctaagacaccccac
atcgttgtaaataatcaggtacaaaagtacgaccacatcagatcaactatcaacaccaat
acattgagcaaattaattacgaatgatgaaattaaggcggttttaccattagaatatgta
tctatatttttagtgaatatttactgccgcaagcctatattgataccttccgacaagaat
ggatttggcttccttgtcccaaaagttaatcaaaatcacgaaagcttactaggaataatg
tatgattcagacatagaacgtcatgttaaaccattatatctgaatgagaaaatctcgact
gacaattataataaaataaccttaatgatgggaggtcactactacaacaagatagggatt
ccctcaaacaaccttaacgttaaagcaatcaaaaatgtattgtcatcaatcttaaatact
agcctaaaggaccacaacttaatattcagaaacgaggctcaaatgaccgataagtcactt
tctctcgaagaaaatgatattatgatttcgtataatttacaccgagactgtatcccccag
tacaatgttggttacgagaaacaaaaacaaaaattgtatgaaattatgaaccagcagtgt
aacggtaaattctcgctaggtggaatgggcttcgccgcaggtatgggagtacccgattgc
gtaatgaatggattagttgattccttagaaatcgcctag

DBGET integrated database retrieval system