KEGG   Debaryomyces hansenii: DEHA2B11088gHelp
Entry
DEHA2B11088g      CDS       T01026                                 

Definition
DEHA2B11088p
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dha  Debaryomyces hansenii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DEHA2B11088g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     DEHA2B11088g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:869426..870940
Genome map
AA seq 504 aa AA seqDB search
MSTERLIYSPKHLTEVTLEERGLRITDQSLEALHGNDHTHNFLSACLQTDSRTGESESHI
PFRNIIWCEKISSDDYQDLYELAYMYSSSQSLKPERIQIQIKSVDPGHAHLSSDINDLSK
YILSRAYDKSLISPSILVIINPHGGQGNAVSIYEQKILPILKEAHVNFKYQETKYQGHAM
EISKGLDVNRYDIIACCSGDGIPHEVINGFYQRSDKGLEAFNKIAVTQLPCGSGNALTLS
THGSNDASVATLSMLKSQKAKLDLMAVTQGTGNKEKTSLSFLTQCYGIIADSDIGTEHLR
WMGPIRFDLGVTYKVLKRSKYPCDIYVNCITESKQDISDHFDKHYKQNYGPKTLTAEEFE
LKYPGLDQDPPSNWVKLPEITTSNLNILYVGKMPYVSNDAQFFPAALPNDGSMDMIITDT
NMSIIDTTSTLLSVSKGTHVYSDKVHHSKVLSYRLVPKLANPDNHYISIDGENFPTEQLQ
VEIMPGILTGLLNDGNFVDTSFSK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacggaacgattgatatatagtcctaagcatttgactgaggttaccctagaagag
aggggattaagaatcacagaccaatcgctcgaagcattacacgggaacgatcacactcac
aattttctatcagcctgtttacagacagattctaggactggcgaatcggagtcacatatt
ccgtttagaaatatcatatggtgtgaaaaaatatcatcggatgattatcaagacttgtat
gagttggcgtatatgtactcgtcatcacaatcgttaaaaccagaaagaatacaaattcaa
attaaatctgttgatccgggccatgcacatttatcgtcagacattaatgatttaagcaaa
tacatactttcgcgggcatacgacaaaagtttgatttccccatcgatacttgttataata
aacccacatggaggacaaggtaatgcagttagtatatacgagcaaaagattttacctatc
ttgaaggaggcccacgttaactttaaataccaagaaaccaaataccaagggcacgcaatg
gaaatatctaagggcttagatgttaatagatatgatataattgcatgctgctctggtgat
ggtatccctcacgaggttatcaatgggttttatcagcgctctgataaaggtttggaagct
tttaacaagatcgcagtaacacaattaccatgtggttctggtaacgcacttactttgagt
acacatggaagcaatgatgcctcagttgcgactttgagcatgttgaaatcacagaaggct
aagttggatcttatggcagtaacccaaggtaccggaaataaggaaaaaacaagtttgtca
ttcttaacccaatgttatggaataatagcagattctgatattggaactgagcatttaaga
tggatgggcccaataagatttgatttgggtgttacatacaaggtgcttaaaagaagcaag
tatccgtgtgatatttatgtcaattgcataaccgaaagcaagcaggatatttcggatcat
tttgataaacattacaaacaaaattatggccctaagacattaactgctgaagaattcgaa
ttaaagtatccaggattagaccaagatccacctagtaattgggttaaactacctgagatt
acaacatcaaacttgaatatattatatgtaggcaaaatgccttatgtttccaatgatgca
cagttttttcctgctgctcttccaaatgatggttcgatggatatgatcataacagatacg
aatatgtcgatcatagatactacttctactttgctttctgtgagtaagggaactcatgtt
tatagtgataaagttcaccactctaaagttctaagctacagattggttccaaagcttgct
aaccctgataaccattacatttccattgatggagagaattttccaactgagcaattgcaa
gtagagattatgccgggtatactaactggattgttaaatgacggcaactttgttgataca
tctttttccaaataa

DBGET integrated database retrieval system