KEGG   Debaryomyces hansenii: DEHA2B12034gHelp
Entry
DEHA2B12034g      CDS       T01026                                 

Definition
DEHA2B12034p
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
dha  Debaryomyces hansenii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dha01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dha00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:943526..945073
Genome map
AA seq 515 aa AA seqDB search
MTSDLLKRHVLMIDNYDSFTWNLYQYLYQSRLCGKVDVYRNDKIDIATIENEIKPDIIFI
SPGPGHPSTDSGVSRDVIDYFKGKLPIFGVCMGLQCVFDVFGGDVSYAGEIVHGKTTTIK
HDGKGMFANVPQSVAVTRYHSLAGTQQTLPDSLEVTASTETSPEIIMGVRHKEYTIEGVQ
FHPESILTESGQIMIDNLLSVQGGTWKENDASRGAVTPARKENILVKIFEQRKEDYKIIE
KLPGRSFEQLQVSLSLSVAPSLINFYDRIIYTQKELKQTIILSEFKRASPSKGDINIQAH
PGKQALTYATNGCSTISVLTEPKWFKGSLDDMALIRRVIDTPTQENYKRPAVLRKEFIFN
KYQILEARLAGADTVLLIVKMLSNSQILQELYEYSLSLGMVPLVEVNDKSELDLAVKLTY
KGDNKEPLIIGVNNRNLSTFDVDLGTTSSLVDAAKNKSGRKGDVVVLALSGITNVDDVKK
YKYEDNVDGFLIGESLMRAEEQGRAGDFLNELCTC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgactagtgatttgctcaaaaggcatgttttgatgatagataattatgattcctttact
tggaacttatatcaatatctctatcaatctcgtttatgtggaaaagtcgacgtctatcgt
aatgataaaattgatatagctaccattgaaaatgaaatcaaaccagatattatcttcata
tctccgggccctggacatccaagcacggattctggtgtttcaagagatgttattgactat
ttcaagggcaagttgccgatatttggtgtctgtatgggattacaatgtgtgtttgatgta
tttggtggtgatgtttcttatgccggagaaattgttcatggtaaaaccaccactataaag
catgacggaaagggtatgtttgccaatgtgccgcaatcggttgctgttaccagatatcat
tcgttggctggtactcaacaaactttgcctgatagtcttgaggtcacggcttcgaccgaa
acgtctcctgaaattattatgggtgtcagacacaaggaatacacaatagaaggtgtgcag
tttcatccggagtccattttaaccgaatctggtcagataatgattgacaacttattatct
gttcaaggtggtacttggaaagagaacgatgcttccagaggtgccgttacgccggccagg
aaggaaaacatattggtgaagatctttgaacagcgtaaggaagactacaaaatcattgaa
aagcttccaggtagatcctttgaacaattacaggtgtcattatcgttgtcggtggcgcct
agcttaatcaatttctacgatcggattatctacacgcaaaaagaattgaaacaaaccatt
atcttgtctgagttcaagcgtgcttcaccatctaaaggcgatatcaatatccaagctcat
cctggtaagcaagccttgacttacgccactaatggatgctcaaccatctcggtattaacc
gaaccaaaatggttcaaaggctcattagatgacatggcattaatacgtcgtgttatcgac
actcctacccaggaaaattacaaaagacctgccgtcttgaggaaagagttcatcttcaac
aagtaccaaatcttagaagcccgtttagctggtgccgataccgtcttgttgatcgtcaaa
atgttgctgaactcccaaatattacaagaattgtacgagtattccttgtccttaggtatg
gtcccattggtggaagtcaatgataagtctgaattagatttagccgtcaagcttacttac
aagggtgacaacaaagaacctctcataattggggttaataaccgtaacttgtcaactttt
gacgttgatttaggaaccaccagttccttggttgatgctgctaaaaacaagagtggcaga
aagggcgatgtggtggtcttagcattatctggaataactaatgttgatgatgtcaaaaag
tacaaatacgaggacaatgtcgatggttttttgataggagaaagtttaatgagggctgaa
gagcaaggaagagctggtgacttcttgaatgaattatgtacttgttag

DBGET integrated database retrieval system