KEGG   Debaryomyces hansenii: DEHA2B12386gHelp
Entry
DEHA2B12386g      CDS       T01026                                 

Definition
DEHA2B12386p
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dha  Debaryomyces hansenii
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dha00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    DEHA2B12386g
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     DEHA2B12386g
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   DEHA2B12386g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:971581..972870
Genome map
AA seq 429 aa AA seqDB search
MTSMEHNETSTKSLNDISLEELSKRQQQQNIYVQPVLGSQTDDNRMSIDKQSDGNTGDEE
MGSVARGGPGDTRDDNNGGMGTTESSNTSSQTDLTKKPSRHGDRDTTTKGKYTLNDFQIL
RTLGTGSFGRVHLTRSIHNGRFYAMKTLKKERVVNMKQVEHTNDERRMLKLAQHPFIIRM
WGTFQDCHNLFMIMDYIEGGELFSLLRKSQRFPTPVAKFYAAEVFLAIEYLHELDIIYRD
LKPENILLDKNGHIKLTDFGFAKEVSDVTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGI
LIFEMLTGYTPFYDPTPMKTYENILNGTITYPDYLPPDILDLLQKLIVKDLSQRLGNLQD
GSDGIKNHPWFKEVIWERLLSRDIETPYEPPITSGIGDTSQFDRYPEDKDLDYGISGVSD
PYGSMFGDF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgatggagcataatgagaccagcaccaaatcgctaaacgatatatctctagag
gagttgagtaagaggcagcagcagcagaatatatacgtgcaaccggttttggggtcgcag
acggacgataaccgcatgagcatcgacaagcagagcgacggaaacacaggggacgaagaa
atgggcctggtagccagaggaggtccaggagacacgagagatgataataatgggggaatg
gggactacagaaagctcgaatacgctgtcgcagaccgacttgacgaagaaaccgtcgaga
catggcgaccgtgatacaacgaccaaaggcaagtacacgttgaatgacttccagatcttg
cggacgttgggtacagggtcgtttggccgggtgcacttgacacggtcgatccataacgga
cgtttctacgccatgaagacgttgaagaaggaacgggtggtaaacatgaagcaagtggag
cataccaacgacgagagacgcatgttaaagctcgcgcagcacccgttcatcatcagaatg
tggggcactttccaagattgccataatttgttcatgatcatggactatatagaagggggc
gagttgttctcgctcttgagaaagtcccagaggttcccgaccccagtggccaagttctac
gccgccgaagtgtttttggccatcgaatacttgcacgagttggatattatctaccgtgac
ttgaagcccgaaaacatcttgttggacaagaatgggcatatcaagttgactgactttggg
tttgcaaaagaagtcagcgacgtcacatacacgttatgcggaacccccgattacatagcc
ccagaagtggttgcaactaaaccttacaataaatcggtggactggtggtcgtttgggatc
ttgatctttgaaatgctcactggttacacgccattttacgacccaaccccaatgaaaact
tatgaaaatatattaaatggtacaatcacctatcctgattatttgccgccggatattttg
gatttactccaaaaattgatcgttaaggatttgtcccaaagactaggtaacttgcaggat
ggttctgatggaataaagaaccacccatggtttaaggaagttatctgggaaagattactt
tcgagagacatagagaccccttatgaacccccaattacatcgggtattggtgatacttct
caattcgataggtatcctgaagataaagatttggattacggtatcagtggtgtttctgat
ccatatggttccatgtttggggacttctaa

DBGET integrated database retrieval system