KEGG   Debaryomyces hansenii: DEHA2B14718gHelp
Entry
DEHA2B14718g      CDS       T01026                                 

Definition
DEHA2B14718p
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dha  Debaryomyces hansenii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dha00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:1159294..1160949
Genome map
AA seq 551 aa AA seqDB search
MTTEKASLLGDERMSLYNTKKKSSFGKYLKYLTHVVVIIGTVYLCLSNMTGSEPVGVDTN
KKKNVIFMVTDGMGPASLSLARSFKQFRDQLPMDDVLQLDQHLVGSSRTRSNSSLITDSA
AGATAFSCGLKSYNGAIGVSSDSEPCGTILEALKLQGYMTGLVVTTRITDATPAAFSSHV
DQRFQEDMIAEQQLGEYPLGRMVDLIIGGGRCHFLPKSQKGGCRSDDRNLVEEAQHEKGW
NYVGNREQFDDLKQGHNVQFPLLGLLADTDIPYDIDRDPKVYPSLAEQVKVALTALSKAT
KDSDKGFFLLIEGSRIDHAGHHNDPAAQVREVLAYDEAFKDVLKFIDETETDTIAISTSD
HETGGLVTSRQNSPHYPDYVWYPEVLLNSTHSGEYLSSKIVNFTSSTDDVTTLDKFIAKE
ILEKDLGIMDYTQEEIETIKHFSNDQSNLLYVLNNLVSVRSQTGWTTHGHSAVDVNIYAY
TNSKQISSQLISNKPYHGLLGNHENIEIGAFMESITGVDLDKITKLIKKTKHSITTKFNS
IQVDEMHHGAY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagaaaaggcctccttattaggggatgaacgaatgtcgttatataatacaaaa
aagaagagttcattcgggaaatacttgaagtatttgactcatgtggtggtaattattggc
actgtgtacttgtgcttatcgaacatgacggggtcggagccggtcggagttgataccaac
aagaagaaaaacgtcatattcatggttacagatggtatggggcccgcatcgttatcgctc
gcaagatctttcaaacagttcagagatcaactccctatggatgatgttttgcaattagat
caacatttagtgggatcatcgagaacaaggtctaattcgtctctcattacagattcggcg
gctggtgccactgctttttcatgtggattgaagtcgtacaacggagccatcggagtttca
tcagattctgagccatgcggaacgattttggaggctttgaagctccaggggtatatgacg
gggttggttgttactacgaggataactgacgctacaccagcggctttcagctcgcatgtg
gaccagagattccaagaagatatgattgctgaacaacagttgggtgaatatcctttgggg
cgtatggtagatttgataatcgggggaggaagatgtcattttttaccaaagtcacaaaag
ggtggatgtcgttcagatgatagaaatttggttgaggaagcacagcatgaaaagggatgg
aactatgtgggaaaccgtgaacagtttgatgacttgaaacagggccataatgttcagttt
cctttgttgggtttattggccgacactgatattccatatgacatcgatagagacccaaag
gtctatccgtcattggcagaacaggttaaggttgcattgacagctttatcgaaggctacc
aaagattccgacaagggattctttttgcttatcgaaggctctcgtattgaccatgccggt
caccacaacgatccagccgcccaggttagggaagttttggcttatgacgaagcatttaaa
gatgtgttgaaattcattgatgaaaccgagactgatacaattgcgatttctacttcagat
catgaaactggtggtttagttacatcgagacaaaatagtcctcattacccagactatgta
tggtatccagaggttttgttgaatagcacgcactcaggtgaatatttgtcaagtaaaatc
gtcaacttcacttccagcacggacgacgttactacgcttgacaagttcattgcgaaggaa
atccttgaaaaggatttgggaattatggactacacacaagaggaaattgaaactatcaaa
cacttctcgaacgaccagtcaaacttattatacgttttgaataacttggtttctgtgagg
tcgcaaactgggtggactacccatgggcattcggctgtcgatgttaacatttatgcatac
accaattcgaagcagattagttctcaattaatatcgaacaagccatatcatggtttatta
ggaaaccacgaaaatattgagatcggagcattcatggaatcaattactggtgttgactta
gataaaattacgaaattgatcaagaagacaaagcattcaattacaacaaagtttaattcc
attcaggtcgatgaaatgcatcatggagcttattga

DBGET integrated database retrieval system