KEGG   Debaryomyces hansenii: DEHA2B15532gHelp
Entry
DEHA2B15532g      CDS       T01026                                 

Definition
DEHA2B15532p
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dha  Debaryomyces hansenii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dha00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B:complement(1225722..1226258)
Genome map
AA seq 178 aa AA seqDB search
MVEFFYHDNKDTPENFTDVHNSGEPVSVEDLDKLGVKYFHVTSTNELDDIATKRNYKNRD
EITLNLDSFGGDVDAFNAKMKQFYKEHYHEDEEIRYIIDGEGYFDVRDKQDRWIRAKLVP
NDMLVLPAGIYHRFTLTSALRKVKAVRLFKDEPKWEAINRETGRNSEARTEYLNTIAV
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggttgaattcttctatcacgacaacaaagatactccagaaaactttactgatgttcac
aactcaggggaaccagtaagtgtcgaagaccttgataagcttggagtcaagtacttccat
gttactagcacgaatgaattggacgatattgcgaccaagagaaactataagaatagagac
gagataacgttgaatttggattcatttggtggtgatgtggacgcatttaatgctaaaatg
aagcaattttataaagaacattaccacgaagacgaagagataagatatattattgatggg
gagggatattttgatgtgagagataagcaggatagatggataagggcaaaacttgttcct
aacgacatgttggttttgccagcaggcatttaccatcgttttaccttgactagtgcgctc
agaaaggtcaaggcagttcgattatttaaagatgagccaaaatgggaggccattaacaga
gaaaccggtagaaatagcgaagctcgtaccgaatatttaaatactattgctgtgtag

DBGET integrated database retrieval system