KEGG   Debaryomyces hansenii: DEHA2C03388gHelp
Entry
DEHA2C03388g      CDS       T01026                                 

Definition
DEHA2C03388p
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
dha  Debaryomyces hansenii
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    DEHA2C03388g
Enzymes [BR:dha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     DEHA2C03388g
Exosome [BR:dha04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DEHA2C03388g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:313188..314018
Genome map
AA seq 276 aa AA seqDB search
MNIIELLSVVISIVLSMSSSGNKSSQAGGKEQKLLDHLLSLPEDQLASIRGNPGKVLEAI
DNYPASFMTIGKNKGKIIVDKMKEVKPMVMIELGCYVGYSAILFANELPKEQGTKYYSFE
ANPDFANIASQIIDLAGLSHKVQIIVGNAAHTLGGFRDTFKRQGLSYSSLDFIFIDHEKS
LYVPDLRVLESLNLIAPGTVIAADNIIMPGAPEYVEYVQSSPEEKRDFNYRVENVNGKEF
LGRWNIIYKTETIPAITSKGHKDAVEITECVEYLNG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatagaattattatcagttgtgatatcaatagtacttagtatgtcatcatca
ggtaataaatcgtcacaggcgggcggaaaagaacaaaagcttctcgatcatcttctttct
ttgccagaagatcagcttgcctcgataagaggtaacccaggaaaagtgttagaggcaatt
gacaactatcctgcatcatttatgactataggaaagaacaaaggaaagattattgtcgat
aagatgaaggaagttaaacctatggtcatgattgaacttgggtgttacgttgggtattcc
gcaattttatttgcaaatgaattgccaaaggagcaagggaccaaatattatagttttgag
gcaaatccagatttcgccaatatcgctctgcagatcattgatttggcaggcttatctcac
aaagtccagattatcgttggcaatgccgctcataccttagggggcttcagggatacgttc
aagagacaaggattatcgtactcttcgctagacttcattttcattgaccacgagaagagt
ctttatgttcctgatctcagggttcttgaatcattgaatttaattgcacctggtaccgtt
atagcggctgataacattatcatgcctggggccccagaatacgtagaatacgttcaatcg
tcgccagaagagaagcgtgattttaactacagagtcgaaaacgtaaatggcaaagagttc
cttggaaggtggaatataatatacaagactgaaactattccagccattacttccaagggt
cataaggatgcagttgagattacagaatgcgttgagtatctcaatggttag

DBGET integrated database retrieval system