KEGG   Debaryomyces hansenii: DEHA2C06864gHelp
Entry
DEHA2C06864g      CDS       T01026                                 

Definition
DEHA2C06864p
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
dha  Debaryomyces hansenii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dha00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:604272..608837
Genome map
AA seq 1521 aa AA seqDB search
MTGRPIILRLSNTGEPVNNTAVQNGVLILPSVALPKDYKKGDALFNLHLTLNAASAVSNN
GTIFSNVPREYSTKFDRSKFYEYPLDTSFHRDILVNIPISKPGSYCYYICYEDKEQKKRT
TDKFYFVVPPNLSIGNEYVPFNNINIQSVISKWIGPLDQWNALFEDISKKGYNMIHFTPL
QERGVSNSPYSIYDQLRFDPNLFKSNDDAAKFLKELLAKNNLLSLTDVVLNHTANNSEWI
REYPDAGYNVENSPHLQSAIELDEKLLEFSNKLDEFGLPEDIKTQDDLNAIADGIVKHVV
NPLKLWQYYVFDKQESVDALKNAFENGNSKISPGTIPSDIDSNNIKQLSKYILETCNTRG
QVILEDRFANKLDSAKFLAVLFTLLDYPSNKVDFETISSKASSIIDEINLDLYAVYDDDV
KSIKNQLKDRIRYMRLDNDGPKLGPVSKDNPLTEPYFTRFKGADGKQWALANNGWIWGGN
PLQDFASSESKAYLRREVVIWGDCVKLRYGSKEEDSPHLWKRMIDYTKECASVFDGFRID
NCHSTPLHVGEKLLDVARSVNPDLYIVAELFSGSEEMDKVFVERLGINSLIREAMQAGSV
SELSTLVHKHGGRPIGSLTWLPLDEFAYPALSEPEKDKYGDSYSELEIPKALTSSAPHAL
FMDCTHDNEMPAQKRTVEDTLPNAALVAFCSSAIGSVFGFDECYPELLNVVDEKRIYTYG
ENGIGSIKQKLHSIRKSLATESDDISRDHEMYIHHEGQYITIQRHNSRTGKGWFLIARTK
FNDNAEHQTLSPSVLGGTKVKNEFAYTLKKVDGHQRDDKKLTGIPVALEEIPAPEIEYND
KDSKIHVNESFIPGSIAVFSTEIPKVDVSLDTFVREGAVEASLDLDLYDLNALMYRAEPE
ERDASDGSDGVYQIPKHGSLIYAGFEGWISVLKNVIWQNDLAHPLCDHLREGEWPLDYVV
NRLNKYSQGSKSLQKFQDWLSSRIEAIRIVPYFLRPHYFALVIGVAYEACRFRILRLFPK
EIQDGTNFVQSLALTSVQMVAKMRKTSLKSKEQVPCIAAGLPHFSNDYMRCWGRDVFISF
RGLLLAPGRYEDAKQHILGFAQTLKHGLIPNLLDSGRNPRYNARDAAWFFIQAIQDYVTH
APNGTSILDEKVARRFPLDDTYIPYDDQKAFSYETSVRDIIFEILQRHAKGIKYREANAG
KNLDSQMSDEGFNVEVHIDWQTGLVHGGSQSNCGTWMDKMGESEKAGSKGVPGTPRDGAA
VELQGLLKSALRFVNILHKENLFEYTEVEREDGSAISLKDWEKLILNNFERCFYVPEDPS
HDSEYEIDSSIVNRRGIYKDLYKSGKPFEDYQLRANFPIAMVVAPELFTPSKALHAICVA
DKVIRGPVGMRTLDPSDWNYRPNYNNGEDSDDFATSKGRNYHQGPEWVWCMGYFLRAFLL
FHYVNSNEYKEGKDPSVSVLTALNERLQGHMKWIRESEWSGLTELTNKDGAICPDSSPTQ
AWSSSCLLDLYFDLWNDQEYP
NT seq 4566 nt NT seq  +upstreamnt  +downstreamnt
atgacaggacgtccaattattctccggttatcgaatactggggagccagtcaataatact
gctgtacagaatggggtattgatcttgccgagtgttgcactccccaaggattataagaag
ggagatgctttgtttaatttacaccttacattaaatgcagcttcggcggtatctaataac
ggaacaattttctctaacgttcctcgagaatattcgacaaaatttgatagaagtaaattc
tatgaatatccccttgatacttctttccatagagatatcttagtgaacattccgatttcg
aagccgggtagttattgttactatatttgctatgaggacaaggaacaaaagaaaagaacc
acagacaagttttatttcgttgtaccacctaacttgagtatcggcaacgagtatgttcca
tttaacaatatcaacattcagtctgtcatttcaaagtggattggacccttagaccaatgg
aacgcattatttgaggatatctcaaaaaaaggttataatatgatccattttacgcctttg
caggagagaggtgtatcaaattcaccgtattcaatttacgaccagttgagattcgatccc
aacttatttaaaagcaatgatgatgctgctaaatttttgaaggagttattagcaaaaaac
aatttattatctttgactgatgttgtgttgaaccatactgcaaataactctgaatggatt
agagaataccccgatgcaggttacaacgtggaaaactctccacatttgcaatctgctatc
gagttagatgaaaaattgcttgaattttctaataaattagatgaatttggtttacctgag
gatattaaaacgcaggatgatttgaatgcaattgctgatggaattgtgaaacatgtcgtg
aatccgttgaaattatggcaatattatgtttttgataaacaagagtccgttgacgctctt
aagaacgcttttgaaaacggaaattcaaagatttctcctggtacaattccttctgatatt
gattcaaacaatatcaagcaattgtctaaatatattttagaaacgtgtaatactagagga
caagtgattttagaagatagatttgccaacaaattagactccgccaagtttttggccgta
ttatttactttgttggattatccttccaataaagttgattttgagacaatttccagtaag
gctagttcaataattgatgaaattaacttggacttatatgccgtttatgacgatgatgta
aaatcaattaaaaaccaattaaaagatagaattagatacatgagacttgataatgacggc
ccaaagttaggcccagtttcgaaagataatccattaactgaaccatattttacaagattc
aaaggagcggatggaaaacaatgggctttggcgaataacggttggatttggggaggtaac
ccattacaagactttgcgtcaagtgaatctaaggcctacttgagaagagaagtggtaatt
tggggagattgtgtcaaattaagatatggaagcaaagaagaagattcgcctcatttatgg
aaacgtatgatcgactatacgaaagagtgtgcatctgtattcgatggttttagaattgac
aattgccattccactccgttgcatgtgggggaaaagttattggatgttgccagaagtgtt
aatccagacttatacatagttgctgaattatttagtgggtctgaagagatggataaagtg
tttgtcgaaagattaggtatcaatagtcttattagagaagccatgcaagcaggaagtgtt
tccgaattatcaacgttggttcataaacatggtggtcgtccaattggatccttgacctgg
ttgccattagatgaatttgcttatccagcattatcggagcctgagaaagacaaatatggg
gattcatattccgaattagaaattccaaaggctttaacttcgctggctccgcatgcttta
ttcatggactgtactcatgacaatgaaatgccagctcaaaagagaacagtagaggataca
ttaccaaatgcagcattagttgcattctgctcttctgcaattggatctgtatttgggttt
gatgaatgttatccagaattactaaacgttgttgatgagaaacgtatttatacatacggt
gaaaatggtattggtagtataaagcaaaaattacattctattagaaagtcgcttgctact
gaaagtgatgatatactgagagatcatgaaatgtatattcatcatgaaggtcaatatatt
actattcaaagacataactccagaactggtaagggttggtttttaatagcaagaacgaaa
tttaatgacaacgcagaacatcaaactttatcaccttcggtattaggaggaacaaaagta
aaaaatgagtttgcatacactttaaagaaagttgatggtcatcaacgcgacgataagaaa
ttgaccggtatccccgttgctttagaagaaattccagcgccagaaatcgaatacaatgat
aaagattctaaaattcacgtaaatgagagttttatcccaggatctatagctgtgttttca
actgagatcccaaaggtagacgtctcattagatacgtttgtgagagaaggagccgtggaa
gcttcattagacttagacttatacgacttaaatgccctaatgtatcgtgcagaaccagaa
gaacgtgatgcgagcgatggaagtgatggtgtttatcaaattcctaaacatggcagcttg
atctatgccggttttgaaggctggatttctgtattgaaaaatgtgatatggcaaaatgat
cttgcgcatccgctttgtgatcatcttagagaaggtgaatggccgcttgactatgttgtc
aatagattaaataagtattcgcaaggctccaaatcattacaaaaattccaagattggttg
tcaagcagaattgaagccattagaattgtcccttatttccttaggccacattattttgcc
ttagttattggtgtcgcctatgaagcctgtagattcagaattttgagattgttccctaag
gagattcaggatggtacaaactttgtgcagagtttggcattaacttcggtacaaatggta
gcaaagatgaggaagacatcattaaagagtaaggaacaagttccttgtatagcggctggc
ttaccacatttcagtaatgattacatgagatgctggggtagagatgtattcatttctttc
agaggattattattggcgcctggtaggtacgaagatgctaagcaacatatattaggattt
gcccagactttgaaacatggattgattccaaatcttttagattccggaaggaacccacgg
tacaatgctagagatgcagcttggttttttatccaagcaattcaagattacgttacgcat
gcgcctaatggaactagtatattagatgaaaaagttgcaagaaggtttccgttagatgat
acctatattccttatgatgaccagaaagcttttagttacgaaacttccgtcagagatatt
atatttgagattttacagcgccatgccaagggcatcaaatatcgcgaagcaaatgccgga
aagaacttagattcccaaatgtcagatgaagggtttaatgttgaggtacacattgattgg
caaactggtcttgttcatggtggatcccagtcgaactgtggtacgtggatggacaaaatg
ggtgaaagcgaaaaagccggctcgaagggtgtacctggaaccccgagagatggtgctgcc
gtcgagcttcaagggttattgaagagtgctctcagattcgtcaatattttgcataaagaa
aatttatttgagtataccgaagttgaacgtgaagatggatccgctatttctttaaaggat
tgggaaaagcttattttgaataattttgaaagatgcttttatgttcctgaagacccaagt
cacgacagcgaatacgagatcgattcgctgatcgttaacagaagaggcatatataaggat
ttatacaagagcggtaaaccattcgaagattatcaattacgtgcaaacttcccaattgcc
atggttgtggctcccgaactatttactccgtccaaggcattgcatgctatctgtgtcgca
gataaggttattcgaggccctgttggtatgagaactttggacccatccgactggaactac
agacctaactataacaacggtgaagacagtgatgattttgccacatctaagggaaggaat
taccaccagggtcccgagtgggtttggtgtatgggctactttttgcgtgcctttttatta
ttccattatgttaactccaacgagtacaaagaaggtaaggatccttcggtcagtgtctta
acagcccttaatgagagacttcaaggccatatgaaatggatcagagaaagcgaatggtct
gggttgactgaattgaccaataaagacggcgcgatttgtccagactccagtcctacccag
gcatggagttcgtcgtgtctcttggacctttatttcgatttatggaacgaccaggaatat
ccttaa

DBGET integrated database retrieval system