KEGG   Debaryomyces hansenii: DEHA2C07238gHelp
Entry
DEHA2C07238g      CDS       T01026                                 

Definition
DEHA2C07238p
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dha  Debaryomyces hansenii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dha00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(638754..639608)
Genome map
AA seq 284 aa AA seqDB search
MSQPEPNPFIIFATVAAIISSAVAYYFFQLSRKNAPVLKPNDFQKFPLIEKTRVSHNTCV
YRFGLPRSTDRLGLPIGQHIAIGATINDKEVVRSYTPISTDDELGYFDLLIKAYENGNIS
RHVESKKIGETIDIRGPKGFFTYTPGMVESFGMIAGGTGITPMYQILTAILRNPEDKTKV
SLVYANVTEDDILLKEELNKMAREHPDRFKIYYVLNTPPENWTGGVGFVTPEIMDKHLPK
ASEATNLLLCGPPPMISAMKKAAVGLGYQKAKPVSKLGDQIFVF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaccagagcctaatccctttattatatttgctactgttgcagcaataatctct
tcagctgtagcatattatttctttcaattaagcagaaagaatgctccagttttaaagcca
aatgatttccaaaagtttccattgattgaaaaaaccagagtttctcacaacacatgcgtt
tacagattcgggttaccacggtccaccgacagattaggtttgccaattggccaacatatt
gctattggagcaactattaatgacaaagaggtggttagatcttacactccaatctccacc
gatgatgaattaggatactttgatttattgatcaaggcttatgaaaatggtaacatttca
agacacgttgagtccaagaagattggggaaaccatcgatatcagaggaccaaagggattc
ttcacctacaccccaggtatggttgaatcgtttggaatgattgctggtggtaccggtatt
actccaatgtaccagattttgaccgcgattttgagaaacccagaagataagactaaggtc
agcttggtgtacgctaacgtgactgaagatgacattttgttgaaagaagaattgaacaag
atggctagagaacacccggacagatttaagatttattacgttttaaacacccctccagaa
aactggaccggtggtgtcggtttcgttactccagaaattatggataagcacttaccaaag
gcttctgaagccacaaacttattattatgtggtcctccacctatgattagtgcaatgaag
aaggctgccgttggcttaggctaccagaaggcaaagccggtctcaaaattaggcgatcaa
atattcgttttctaa

DBGET integrated database retrieval system