KEGG   Debaryomyces hansenii: DEHA2C08316gHelp
Entry
DEHA2C08316g      CDS       T01026                                 

Definition
DEHA2C08316p
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dha  Debaryomyces hansenii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    DEHA2C08316g
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DEHA2C08316g
Enzymes [BR:dha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DEHA2C08316g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(735629..736117)
Genome map
AA seq 162 aa AA seqDB search
MDKTSFYDFKPLDVYGEVYDFSQLKGKVVVIVNVASLCGFTSQYKDLEYLYKTYKERGFV
VLGFPCNQFGSQEPYTEREILQICEKKFGVTFPIMDKIEVNGECEDPLYGYLKNEQRTSL
GFKGIKWNFEKFLISRSGRVVKRYDSTVAPLNFEKAIVELLE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgagtttctacgacttcaaaccgttagatgtatacggcgaggtgtatgat
ttcagtcaattgaaggggaaggtggtggtgattgtaaatgtagcgagtctttgtggattt
acactgcagtacaaagatcttgaatatttgtataaaacgtataaggagaggggatttgtt
gtgcttggattcccatgcaatcaatttgggagtcaagaaccgtataccgaacgagagatt
ttgcagatatgcgaaaagaagtttggagttacgtttcctataatggacaagattgaggtt
aacggagagtgtgaagatccgctttatggatatttgaagaacgagcaacggacgtctctc
gggttcaaagggattaagtggaattttgagaaatttttgattagtagaagtggtagagta
gtcaaacgttacgactcgacagtagccccgctaaacttcgagaaagctattgtagagcta
ctagagtaa

DBGET integrated database retrieval system