KEGG   Debaryomyces hansenii: DEHA2C08536gHelp
Entry
DEHA2C08536g      CDS       T01026                                 

Definition
DEHA2C08536p
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
dha  Debaryomyces hansenii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:dha04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(748905..750950)
Genome map
AA seq 681 aa AA seqDB search
MSDANDTSGNLSPGFENLNIRTPKAVNTESTQSPQRVSHSQINGDIQARILAFQQKRTKP
VNGGHGALNPISKSTSHLSEAPDKPLPPLPPLPTLPTMSLQQRSYSSGDTSDPGLIPSPM
ETENIQNTNHSVNRSMGQSMSQVMGQGISRTSSLKKQEPQQLPFELSKKPSLSQRRGMKL
NLSEMSSPTSASSPDDTSPIGDGKESSVFSNAPKGSVLDNNAMNTTGDLTRRVSERKNKP
NFKLNLANTGGPGVSGMNPQSTSNSNSNSTISSLNSSGSSSTMATNNETNQSKKPQLQGL
FANYSKYVDIKSGSLNFAGKASLHSKGIDFSSGLSFRISLEELEFLEELGHGNYGVVSKV
LHKPTGVLMAMKEVRLELDETKFTQILMELEILHKCDSPYIVDFYGAFFVEGAVYMCMEY
MDGGSLDKIYGKDDGVNDEACLAYITECVIRGLKELKDEHNIIHRDVKPTNILVNSLGKV
KLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLSPTDNTYSVQSDIWSLGLSILEIAAG
HYPYPSETYGNIFSQLSAIVDGDPPRLDPKAFSKDAQLFIKSCLNKNPDLRPSYATLLKH
PWLVNHRDIDPHMDKFVTKKLEELEEQKNKKNLSRSNSVNSSTTTAKPPKESVRSLLKGK
VQAPALHRGGLMNSNRNSVNR
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgcaaatgatacgtcgggcaacttgagtccaggttttgaaaacctaaatatc
cgaacgcctaaggcggtcaatactgagagcactcagtcgccacagagggtatcacattca
cagataaatggtgatattcaggccaggatattggcgttccaacaaaagagaacaaagcca
gtgaatggcggtcatggtgcgttgaatccaatttcaaaatctacgagccatttgagtgaa
gcgccagacaaaccattaccaccattaccacctttacccacattgccaactatgctgtta
caacaaagatcttactctctgggagatactagcgatccaggcttgattccttctccgatg
gaaacagaaaatattcagaatacgaaccatagtgtaaaccgaagtatgggccaatctatg
agtcaagttatgggtcaaggcatttctagaacgtcgagtttaaagaaacaagaaccacaa
cagctaccatttgagttactgaagaagccgtctttatcccaaagaagaggaatgaagctt
aatttaagtgaaatgagtagtcccactagtgctagctctccggatgacacgagccctata
ggtgatggtaaagagagcctggtgtttctgaacgcaccaaagggaagtgtccttgataac
aatgccatgaacactactggcgacttaacaagaagagtatcagaaagaaaaaataaacct
aacttcaaattgaatttggctaatacaggaggtcctggagttagtggcatgaatccacaa
tccacttcaaattcaaattcaaattcgactatctcatcattgaattcttctggatcatcg
tctaccatggccactaacaatgaaacaaatcaatccaagaagcctcagttgcaaggatta
tttgcaaattattcgaaatacgttgatataaaatctggctcgttaaattttgctggtaag
gcctcgttacattcaaaggggattgatttcctgtcaggattgctgttccggatctcgtta
gaggaattggaattcttagaagaactaggacatggtaattatggtgttgttctgaaggtt
ttgcataagccaacgggtgtactaatggccatgaaagaagttagattagaattggatgaa
acaaaattcactcaaatcttaatggaattggaaatcttacataaatgtgactcgccatat
attgttgatttctatggagctttctttgttgaaggagctgtttatatgtgtatggagtat
atggatggaggttcgttggataagatatatggaaaggatgatggtgtcaatgatgaagca
tgtcttgcatatataaccgaatgcgttatcagaggattgaaggaattgaaggatgagcat
aatattattcacagagacgtgaaacctacgaacattttggtcaattctctaggaaaagta
aagttatgtgattttggagttagtggtaatttagttgcgtcgttagcgaaaactaatatt
ggttgtcagtcctatatggccccggaaagaattaagtcgttaagtccaaccgacaatacc
tattctgttcagtccgatatttggtctttaggattaagtattttggaaatcgcagcaggt
cattatccttatccatctgaaacttatggtaacatattttcccaattaagtgccatcgtt
gacggtgaccctccaagattggatcctaaagcattctctaaagacgctcaattgtttatc
aagagttgtttaaataaaaaccccgatttgagaccttcatatgctacgttgttaaagcat
ccgtggttggtgaatcatagagatattgatcctcatatggataaatttgtaacaaagaag
ttggaagaactcgaagagcaaaagaacaaaaagaacttaagcagatccaatagtgttaat
tcctcaactaccactgccaaacctccaaaagagagtgtccgctctctattgaaaggaaag
gttcaagctcctgcgttgcatagaggcgggctaatgaattccaatagaaacagcgttaat
cgataa

DBGET integrated database retrieval system