KEGG   Debaryomyces hansenii: DEHA2C12804gHelp
Entry
DEHA2C12804g      CDS       T01026                                 

Definition
DEHA2C12804p
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dha  Debaryomyces hansenii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1120655..1122241)
Genome map
AA seq 528 aa AA seqDB search
MLSRKTTPSSNGKTLPLSSQTDSQVQEQTPPPDNFSSMKPCSHIKSVLESKAKENVFITY
RQAVYISQSISKDNIYTQKKDGAVVSNNKLVELKSKSLRCTECSLNNFHHNFICLQCPHV
GCCSHHNHAHVHYKMNQHLFAIDSHNGLLYCFSCGDYINDLELEKIRIGMLTGSSSTLFD
EENIDDNYNNPTVKAVSGLKGFINLGSTCFMSCILQTLIHNPIIKYQFFNNDLHYFNCEH
NYDYSTNGVITEQNACITCSIDNIFKNFFTSDDTEGFGMTNLLMTSWFKKKSLAGSQEQD
AHEFWQFLLNEFHQDYLRVSNKKFDHDHCKCITHTTFSGQLESSIICAECNSTTRTTDPM
IDLSLEIDHMKRSDHLLNLYDCLDLFTKEEKLDVMYKCQHCDNRSRAKKSLRIKKIPPVL
SIQLKRFKHNLHNDTFSKIEIPIDIPLFLNITKYTSASMSPELDGDKIFELFALVCHIGS
VNTGHYIVIIKNGNGQWLKFDDSVISLISQEEVVKANAYLLFYITHKI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctaggaaaactacaccatcttcaaatggtaaaactttaccactatcaagtcaa
acagattcacaagtccaagagcaaacccctccgccagataacttttcaagtatgaaacca
tgttcacacattaaatcagtccttgaatctaaggcaaaagaaaatgtattcattacgtat
agacaagctgtctatatttcccagtctatatcgaaggataatatatacactcagaagaag
gatggtgcagtagtctcaaataacaaactagtcgagttgaagtctaagtctttgagatgc
acagaatgttcactaaataatttccatcataatttcatttgtttacagtgtcctcatgtg
ggatgctgtagtcatcataatcatgctcatgttcactacaaaatgaaccaacatttattt
gctattgattcgcataatgggttgctctactgctttctgtgtggcgattatattaatgac
ctagagttggaaaaaatccgaattggcatgttgacgggttcaagttctacattatttgat
gaggaaaatatcgacgacaattataataatcctactgtcaaagctgttagtggtctaaag
ggttttatcaaccttgggtctacctgttttatgagttgcatattgcaaacattaattcat
aacccaatcatcaagtatcaattttttaataatgatttgcattattttaattgtgaacat
aattatgattacagcaccaatggtgtcatcactgaacagaatgcatgtattacttgtagc
attgataatattttcaaaaatttttttacttcagatgatacagaaggattcggaatgact
aacttgttaatgacatcgtggttcaagaagaaatcgctagcaggatcacaagaacaggac
gctcatgaattttggcaatttctactaaatgaattccaccaagattaccttagagtgtca
aacaaaaaatttgatcatgatcattgcaaatgtataactcatacaacattttctggacaa
ttggaaagttcgataatatgtgctgaatgcaattccacaacaaggacgacagatcctatg
attgacttgtctttggaaattgaccatatgaaaaggagcgaccatctccttaatctatat
gactgccttgatttatttacaaaagaagagaagctagatgtgatgtataagtgccaacat
tgtgataatcgatcaagagccaaaaagtctttaaggatcaagaagattccacctgttctc
tcaattcaactaaagagattcaaacataatttgcataatgatacgttttctaaaattgaa
attccaatagatatccctctatttttgaatatcaccaaatatacttcggcctcaatgtca
ccagaactcgatggtgataaaatatttgaattgtttgcattagtttgccatatcgggtct
gtcaatacaggtcactatatagtaatcattaaaaacggcaatggccaatggcttaaattt
gatgatagtgtcatttcattaatatctcaagaagaagttgtaaaagccaatgcctatcta
ttattttacataactcataagatttaa

DBGET integrated database retrieval system