KEGG   Debaryomyces hansenii: DEHA2C12804gHelp
Entry
DEHA2C12804g      CDS       T01026                                 

Definition
DEHA2C12804p
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DEHA2C12804g
Peptidases [BR:dha01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DEHA2C12804g
Transcription machinery [BR:dha03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     DEHA2C12804g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1120655..1122241)
Genome map
AA seq 528 aa AA seqDB search
MLSRKTTPSSNGKTLPLSSQTDSQVQEQTPPPDNFSSMKPCSHIKSVLESKAKENVFITY
RQAVYISQSISKDNIYTQKKDGAVVSNNKLVELKSKSLRCTECSLNNFHHNFICLQCPHV
GCCSHHNHAHVHYKMNQHLFAIDSHNGLLYCFSCGDYINDLELEKIRIGMLTGSSSTLFD
EENIDDNYNNPTVKAVSGLKGFINLGSTCFMSCILQTLIHNPIIKYQFFNNDLHYFNCEH
NYDYSTNGVITEQNACITCSIDNIFKNFFTSDDTEGFGMTNLLMTSWFKKKSLAGSQEQD
AHEFWQFLLNEFHQDYLRVSNKKFDHDHCKCITHTTFSGQLESSIICAECNSTTRTTDPM
IDLSLEIDHMKRSDHLLNLYDCLDLFTKEEKLDVMYKCQHCDNRSRAKKSLRIKKIPPVL
SIQLKRFKHNLHNDTFSKIEIPIDIPLFLNITKYTSASMSPELDGDKIFELFALVCHIGS
VNTGHYIVIIKNGNGQWLKFDDSVISLISQEEVVKANAYLLFYITHKI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctaggaaaactacaccatcttcaaatggtaaaactttaccactatcaagtcaa
acagattcacaagtccaagagcaaacccctccgccagataacttttcaagtatgaaacca
tgttcacacattaaatcagtccttgaatctaaggcaaaagaaaatgtattcattacgtat
agacaagctgtctatatttcccagtctatatcgaaggataatatatacactcagaagaag
gatggtgcagtagtctcaaataacaaactagtcgagttgaagtctaagtctttgagatgc
acagaatgttcactaaataatttccatcataatttcatttgtttacagtgtcctcatgtg
ggatgctgtagtcatcataatcatgctcatgttcactacaaaatgaaccaacatttattt
gctattgattcgcataatgggttgctctactgctttctgtgtggcgattatattaatgac
ctagagttggaaaaaatccgaattggcatgttgacgggttcaagttctacattatttgat
gaggaaaatatcgacgacaattataataatcctactgtcaaagctgttagtggtctaaag
ggttttatcaaccttgggtctacctgttttatgagttgcatattgcaaacattaattcat
aacccaatcatcaagtatcaattttttaataatgatttgcattattttaattgtgaacat
aattatgattacagcaccaatggtgtcatcactgaacagaatgcatgtattacttgtagc
attgataatattttcaaaaatttttttacttcagatgatacagaaggattcggaatgact
aacttgttaatgacatcgtggttcaagaagaaatcgctagcaggatcacaagaacaggac
gctcatgaattttggcaatttctactaaatgaattccaccaagattaccttagagtgtca
aacaaaaaatttgatcatgatcattgcaaatgtataactcatacaacattttctggacaa
ttggaaagttcgataatatgtgctgaatgcaattccacaacaaggacgacagatcctatg
attgacttgtctttggaaattgaccatatgaaaaggagcgaccatctccttaatctatat
gactgccttgatttatttacaaaagaagagaagctagatgtgatgtataagtgccaacat
tgtgataatcgatcaagagccaaaaagtctttaaggatcaagaagattccacctgttctc
tcaattcaactaaagagattcaaacataatttgcataatgatacgttttctaaaattgaa
attccaatagatatccctctatttttgaatatcaccaaatatacttcggcctcaatgtca
ccagaactcgatggtgataaaatatttgaattgtttgcattagtttgccatatcgggtct
gtcaatacaggtcactatatagtaatcattaaaaacggcaatggccaatggcttaaattt
gatgatagtgtcatttcattaatatctcaagaagaagttgtaaaagccaatgcctatcta
ttattttacataactcataagatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system