KEGG   Debaryomyces hansenii: DEHA2C12848gHelp
Entry
DEHA2C12848g      CDS       T01026                                 

Definition
(RefSeq) DEHA2C12848p
  KO
K08738  cytochrome c
Organism
dha  Debaryomyces hansenii
Pathway
dha00920  Sulfur metabolism
dha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DEHA2C12848g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 2900367
NCBI-ProteinID: XP_458234
UniProt: P00043
Position
C:complement(1123709..1124041)
Genome map
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGANLFKTRCLQCHTVEEGGPHKVGPNLHGVVGRTSGQAQGFSYTDANK
KKGVEWSEQNLSDYLENPKKYIPGTKMAFGGLKKAKDRNDLISYLVKATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaaaggttccgaaaagaagggtgctaacttattcaaaactaga
tgtttacaatgtcacaccgttgaagaaggtggtccacacaaggttggtccaaacttacac
ggtgttgtcggtagaacctctggtcaagcccaaggtttctcatacactgatgctaacaag
aagaagggtgtcgaatggagtgaacaaaacttgtccgactacttggaaaacccaaagaaa
tatatcccaggtaccaagatggcctttggtggtttaaagaaagccaaggacagaaacgac
ttgatttcttacttggtcaaggctaccaaataa

DBGET integrated database retrieval system