KEGG   Debaryomyces hansenii: DEHA2C12936gHelp
Entry
DEHA2C12936g      CDS       T01026                                 

Definition
DEHA2C12936p
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DEHA2C12936g
Peptidases [BR:dha01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DEHA2C12936g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:complement(1130693..1134565)
Genome map
AA seq 1290 aa AA seqDB search
MLSESPSDKENMLKEIDPGKKQFAEDNEVIEIEDDPMEVDLDDGDDDDDEEDDDDDDEVV
IVDSPTSSKQSATHLPAANQFKELADRLMKPLPDYPVKEQTYNVWEIKDWTALKDDKIRG
PKFTCGGFEWNILLFPRGNNNNQLSLYIEPHPITLPGEEKKQWYVCAKFGLDLWNPNDPA
AHYSSGSYHRFNENETDWGFSSLIDIRQLKSVLKDHKRPILENNQINITAYIKVIDDSST
GVLWNTFADYDSKKSTGYVGLNNQGATCYLNSLLQSYFTTKIFRKLVYQIPIDLNKNLNS
VAFSLQKIFYLLSNSKEPVGTLELTKSFGWDSSDAFTQHDVQELNRILMDKLETAMKSTS
KENYLNDIFVGKMKSYIKCCNVPYESSRVEDFWDIQLNVKGFKNLSEAFKNYIEIEMLEG
ENKYQAGDEHGYQDAKKGVVFESFPPVLHLQLKRFEYDFMVDDLVKIDDFYEFPDSIDLK
PYLDEDLPTEVKNENWTYKLHGVLVHQGSISNGHYYAMIKPYAKKDTWLRFDDDKVWKVT
PYQVFQENFGARELSPQEFAKLSRVDQNENLIRRATSAYMLVYYRESELDSILPDDEESI
NKVIPSTISNQIENELKEMESIEKAKQEALYYLNVKFVTSHNFNNFNGFDLYPDPTIQKL
YDESLVDESTVPISLKVKKDDSFLTLYKLIGSQLGYINDDKDIQIEDVQDLPFRLILINH
RNNHTNRTDTPVPDDLMDATINSIYLKCFNRKYDEMVFYVEELNKDLKNINKLTEVESNP
PENFSFDKVFKNIDAVKGKSSDQFKFDDISDQSSYKTIFLKYFDPISNDIKGLTHITVVK
DDTIDSLTKPVNKLLGFPETTALNFYEELSPLKIDSIDPAVTFEKQELSNGDIICIEVCD
VENIPKGGKHANVKEYYKFLFTRLHIQVKPFKADEEEEDSDFVADENNDENDKSVIDPNN
NELTKSDKQNTSFDLWISTQYSYSELAKELANKLGNHIDPEYLRIFIVNYQGVRYPLKTS
NHLSQFFAKSVPVSQITTFEYEVLNITLKEYENKKSIKIYWLNNIIQSQLYDFLIPNDGT
IFDLMNKLLNKVNVPENQLNNILVWAGNDHKYTELIKFERSIDSVNDSFELYAGIFPIEV
EILVNYDMIKSFNDKPIDIADIEDEETKQELVMARNFSKNLNMIPVFHFYKNSNYHHGIP
FVFPVYPNEKFGDTKKRLRKKLGLGLQAFEKVKFALADSNDKGCYIEQGNHDLVLYDEIG
KYENSVSLAIDHPDRSPRRISQFDKGISIK
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcgaatctcctagtgacaaggaaaatatgttaaaggaaatcgatcctggtaag
aaacagtttgcagaagataatgaggtgattgagattgaagatgatccgatggaagtggat
ttggatgacggcgatgacgatgacgatgaagaagacgatgacgatgacgacgaagttgtg
attgttgatagtccgacgagtctgaagcaactggcaacacaccttcctgcggcaaatcag
ttcaaggagttagccgaccgattaatgaaaccattgcctgattatccagtaaaggagcag
acatacaatgtttgggaaatcaaggactggactgcgttaaaagacgataaaatcagaggc
cccaagttcacatgtggaggttttgaatggaacatcttgttgttccccagaggtaacaat
aacaaccaattgtcgctctacatagagccacatccaataacccttccgggggaagagaaa
aagcaatggtatgtatgtgccaagttcgggttggacttgtggaacccaaacgatccagca
gcacattattctagtggttcataccatagattcaacgaaaacgaaactgattgggggttc
tcatcgttgattgatataagacaattaaagtccgtgttgaaggatcacaagcgccctatc
ttggaaaacaaccagatcaatattactgcttacataaaggtcatcgacgattcatcaact
ggggtgttgtggaatacgtttgctgattatgattcgaagaagagcaccgggtatgtgggt
ttgaataatcagggagctacctgctatttgaattctttattacaatcttattttacaact
aaaattttccggaaattagtgtaccaaattccgatcgacttgaataagaacttgaactct
gttgcattctcattacagaaaatattttatcttttactgaattccaaggagccagttggg
actttggaattgacgaaatcgtttggttgggattcttctgatgcatttactcagcatgat
gttcaagaattgaatcgtattttgatggataaattagaaacagcgatgaaatcaacctct
aaggagaattacctaaatgatatatttgtgggtaagatgaaatcctatatcaaatgctgt
aatgttccttacgaatcttctcgggttgaggacttctgggatattcaattaaatgttaaa
ggtttcaagaacttactggaggcatttaagaattatattgaaattgaaatgttagagggt
gaaaataaataccaggcgggtgatgaacatggttatcaggatgctaaaaaaggtgtagtt
ttcgaatcattcccaccagttcttcatttacaattgaaaagattcgaatatgactttatg
gtagatgatctagttaaaattgatgacttctacgagtttcccgactcaattgacttgaaa
ccgtaccttgatgaagatttgcctactgaagtcaaaaatgaaaactggacttataaacta
cacggagttttagttcaccagggtagcatttcaaatggtcattattatgctatgatcaag
ccatacgcaaagaaggatacttggttaaggtttgatgatgataaggtttggaaagttaca
ccttaccaagtgtttcaggaaaattttggcgccagggaattatcgcctcaagaatttgct
aagctctcaagagtcgatcaaaatgaaaatttaattagaagagcaacttctgcttacatg
ttggtctactatcgtgaatctgaattggatagtattttgcctgatgatgaagaatcaatt
aacaaggttatacccagtacaatatcaaaccaaatagaaaatgaattaaaagaaatggaa
agtattgaaaaggctaaacaagaagcgttatattatttgaatgttaagtttgtcactctg
cataatttcaataacttcaatggttttgatttatatcctgatccgactattcaaaagcta
tatgatgaatcgttggtggatgaaagtacagtaccaatcagtttaaaagttaaaaaggat
gatagctttttaaccttatacaaattgatcggatctcaattgggttacattaatgatgat
aaagatattcaaatcgaagacgttcaagatctaccatttagattgattttgatcaaccat
cgtaataatcacactaatagaacagatacgcctgttcctgatgatttaatggatgccacg
attaattcgatatatttaaaatgctttaatagaaagtacgatgaaatggtattttacgtg
gaggaattaaacaaggatttgaaaaatattaacaaattgactgaagttgaatcaaaccca
cctgaaaacttttcgtttgataaagtcttcaaaaatatcgatgcagttaagggaaagagt
tccgatcaatttaaatttgatgacatttcggaccaatcatcgtataagacgattttcttg
aaatattttgacccgatttcaaatgatatcaaaggcttaacacatattaccgttgtcaag
gatgatactatcgactcattgactaaaccagtcaataaattgttagggttccctgaaaca
acagcgttgaatttttatgaagagttatcgccattgaagattgacagcattgatccagct
gttacttttgaaaagcaagaattaagcaatggggatataatatgtattgaagtctgtgac
gtcgaaaatatccctaaaggcggtaaacatgctaacgttaaagaatattataaatttctt
tttactaggctacatattcaagttaaacctttcaaagctgatgaagaagaagaagatagt
gactttgttgcagatgaaaataacgatgaaaacgataaatctgtgattgatccaaataac
aacgaattaacgaagtcagataaacaaaatacttcctttgacctttggatttcaactcaa
tacagttacagtgaattagccaaggaattagccaataagttaggcaaccatattgatcca
gagtacttgagaatttttattgtgaattatcaaggtgtcagatatcctttgaagacttcc
aatcatttatcgcagttcttcgcaaaactggtaccagtttcacaaataactacattcgaa
tatgaagttttgaatattacgttaaaggaatatgagaataagaagtccattaagatatac
tggttaaataatattattcaaagtcaattatacgatttcttaattcctaatgatggtact
atattcgatttaatgaataagttattaaataaggtcaatgtgccagaaaaccagttaaac
aatatcttggtatgggctggaaatgatcataaatatactgaattgattaaatttgaaaga
tctattgattcggttaatgatagctttgaattatatgctggaatatttccaattgaagtc
gaaatattagttaactatgatatgattaagagtttcaatgataagccaattgatatagct
gatattgaagatgaagaaaccaagcaagagcttgtaatggcaagaaatttctcgaaaaat
ttgaatatgattcctgtgtttcatttttataagaacagtaattatcatcatggtatacca
tttgttttcccggtttatccaaatgaaaaattcggtgatacaaagaaaagacttcgtaag
aaattgggcttagggttgcaggcatttgaaaaggttaagttcgctctagctgattccaat
gacaagggttgttatattgaacaagggaaccatgatttagtattatacgacgaaattggt
aaatacgagaattctgtttccttggctatagaccaccctgatagatctcctcgtcggatt
tctcaatttgacaaaggtatttcaattaagtga

DBGET integrated database retrieval system