KEGG   Debaryomyces hansenii: DEHA2C13354gHelp
Entry
DEHA2C13354g      CDS       T01026                                 

Definition
DEHA2C13354p
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dha  Debaryomyces hansenii
Brite
Enzymes [BR:dha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     DEHA2C13354g
Protein kinases [BR:dha01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   DEHA2C13354g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:1172972..1174522
Genome map
AA seq 516 aa AA seqDB search
MGTGWELTKALREQIVKYAGYQQTSISLRQMVQFGPTPSPGSVFLASQFIVEELPIRLAI
KVKNLENSPHGLNRMPSTMKVRDWYAQSFQELTELPKPQISSELAEMLNSHQAETESHQV
NEATTMSPILQEDMKSVEETHNPANSESKNVAINNIFSDDGIVVRTSSAHSHMSSPEQTK
NSKGRSESPTFGKTYYTSCPANVVWPKEVYDYNKSVSDALSKIKKRHDATVATMAQGVQE
WKNEHKTVIVNSQIQTFLDRFYMSRIGIRMLIGQHIALNSSQTSPAKAKINSFLNGQNGG
SSKRSNYVGVICTDCNVGEIAEDAIETAKYICEEYYGLFEAPEIQLIAPKNDISFMYVPG
HLIHMLFETLKNSLRATIEFHTSRLKEKMCQENPDLSFDDVDINDLKFPPIKVIISEGYE
DIAIKISDEGGGIPRSEVPLIWTYLYTTVSQTPTLEPEYNQSSFKAPMAGFGYGLPISRL
YSQYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLP
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccggatgggaattaactaaagcgttgcgagagcaaatcgtgaaatacgctgga
taccagcagacatctatctcgttgagacagatggtgcaatttgggcccactccgtcgcca
ggatcggtttttttggcgtcacagtttattgtggaagaattgccgataagactagctata
aaggtgaagaacttggaaaattcaccgcatgggttgaataggatgccatcgacgatgaag
gtgagggactggtatgcccagtcattccaggaattgaccgaattacccaaaccacagata
tcgagcgaattggccgagatgttgaatagccatcaggcagaaacggagctgcatcaggtg
aacgaggccacgacgatgtctcccatcttgcaagaggacatgaagagtgtagaagaaacg
cataatcctgcgaacagcgagtcgaagaatgttgctatcaacaatattttcagcgacgat
ggaattgttgtccgcacatcgtcggcacattcacatatgctgtctccagaacagaccaaa
aactcgaagggtagaagcgagtcgcctacatttggcaaaacgtactatacatcatgtcct
gccaacgtggtttggccgaaagaagtgtacgattacaataagctggtgagcgatgcgttg
agcaagatcaagaagagacacgatgcgacggtggccaccatggctcaaggggtacaggag
tggaagaacgaacataagacagtaattgtcaactcacagatccagacatttttggacagg
ttctacatgtctagaattgggatcagaatgctaattggacagcatattgcattgaattca
tcgcagacttcaccagccaaggctaagatcaactctttcttgaacggccagaatggtggt
tctagtaagagatccaactacgtgggggttatttgtacagattgtaatgtgggagagatt
gccgaggatgccatcgaaacggccaaatatatttgtgaagaatactatgggttatttgaa
gcaccagagatacagttgattgctcctaagaatgacattagcttcatgtatgtcccaggc
catttgattcacatgctattcgaaactttgaaaaactcattgagagcgaccatcgaattc
catacttccagattgaaagagaagatgtgccaggagaatcctgacttgctgtttgatgat
gttgacataaacgatttgaagtttcctcctataaaggtaattatttccgaaggttacgaa
gacatcgctatcaagatcagtgacgaaggtggtggtattcccagaagtgaagtaccattg
atttggacatatttatacactacagtcagccaaactcctacattggaacctgaatacaac
caaagctcgttcaaggcccccatggctgggttcgggtatggtttgccaatatcaagattg
tattcacaatactttggtggggacttgaaattgatctccatggaaggttatggtactgac
gtttacttacatttgaatagattgagtagttcttctgaacctttaccatag

DBGET integrated database retrieval system