KEGG   Debaryomyces hansenii: DEHA2C13552gHelp
Entry
DEHA2C13552g      CDS       T01026                                 

Definition
DEHA2C13552p
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
dha  Debaryomyces hansenii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DEHA2C13552g
Enzymes [BR:dha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     DEHA2C13552g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C:1192549..1193253
Genome map
AA seq 234 aa AA seqDB search
MKGKLALVVVDLQEDFLPDNGSLAVAEGRSIVPLINELLNTEKYRWSAVIATQDWHPEDH
CSFASQHKVSPYSEMEFKHPLGERDTNGEIRTQMQVVWPDHCIQNSFGSKLDPQFEAAFN
QLDPNIPRTIVKKGYLKDREYYSCFQDCWKLHKTEMQDYLRNLGISDVVFVGIAYDFCVL
NSALDCAKSGFNTYVIKDCCKSVFPDKVLATEKIYATENVKIISTEDLSFNEHK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcaaattagcgctagttgtagtagatttgcaagaggacttcttgccagataat
ggatcgttggctgtagctgaaggaaggtccattgttccattaattaatgaattgcttaat
acagaaaaataccggtggtctgcagtgattgcaactcaagattggcacccagaagatcat
tgttcgtttgcatcacagcataaagtttctccgtactcagagatggaatttaagcatcct
cttggagagcgggatacgaatggtgagataaggacgcaaatgcaagttgtgtggcctgat
cattgtattcagaattcgtttggatcaaaacttgatccacagttcgaagctgcattcaat
cagctagacccgaatattcctaggacaattgtgaagaaagggtacttgaaggacagggaa
tactattcctgttttcaagattgttggaaactacacaagaccgaaatgcaagactatttg
cgaaatcttggtatcagcgatgttgtctttgtcggaattgcctacgacttttgcgttttg
aactcagctcttgattgtgcaaagtcaggtttcaatacgtatgtcattaaggattgctgt
aaaagtgtgtttcctgacaaagtgttggctacagaaaaaatatatgctactgaaaacgtg
aaaattatatcaacagaggatttatcgttcaatgaacataaataa

DBGET integrated database retrieval system